KEGG   Rattus norvegicus (rat): 362800Help
Entry
362800            CDS       T01003                                 

Gene name
Itgb8
Definition
integrin, beta 8
Orthology
K06591  
integrin beta 8
Organism
rno  Rattus norvegicus (rat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:rno04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:rno04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:rno04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:rno04510]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:rno05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:rno05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:rno05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q33
AA seq 560 aa AA seqDB search
MLKIRPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSKKMALFSHDFRLGFGSYVDKT
VSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEG
GFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYV
KSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGAIAGEIESKAANLNN
LVVEAYKVLFNVTVVMKTCDIIGGKNYAIIKPIGFNETTKVHIHRSCSCQCEDHRGLKGQ
CAEAAPDPKCPQCDDGKCHFDEDQFPSEACKPQEDQPVCSGRGVCICGKCLCHKTKLGRV
YGQYCEKDDFSCPYLHGDVCSGHGECEGGRCQCFNGWEGDRCQCPSASAQHCVNSKGQVC
SGRGTCVCGRNCLQCLHPHNLSQAVLDQCKASCAVMEQHPVAQTSECLSGPSYLRIFFII
FIVTFLIGLLKVLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKP
EEIKMDISKLNAQEAFRCNF
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatccgtcccctgaagaagtaccctgtggatctttattatctggttgatgtg
tcagcatcaatgcacaataatatagaaaaattgaattccgttggaaacgatttatctaaa
aaaatggcccttttttcccatgacttccgtcttggttttggctcatatgtggataaaact
gtctcaccatacattagtatccacccggaaaggatccacaatcagtgcagtgactacaat
ttagactgtatgcctccccatggatacattcatgtgctgtctctgacagaaaacatcact
gagtttgaaaaagcagtccacagacaaaagatctctggaaacatagacactcctgaagga
ggttttgatgccatgcttcaggctgccgtctgtgagagtcatattggatggcgaaaagaa
gctaaaagattgctgctggtgatgacagaccagacatcacatctcgctcttgacagcaaa
ttggcaggcatagtggtgccaaatgacggaaactgccatctgaaaaacaatgtctacgtc
aaatcaacaaccatggaacatccatcattaggtcaactttccgaaaagttaatagacaac
aacataaatgtcatttttgcagttcaaggaaagcagtttcattggtacaaggaccttctg
ccccttttgcctggtgccattgctggtgaaatagaatccaaagctgcaaatctcaacaat
ttagtagtagaagcctacaaggttcttttcaatgtgacagttgtgatgaaaacatgtgat
atcataggaggaaaaaactatgcaataatcaaacctattggtttcaatgaaaccactaaa
gtccacatacacagaagctgcagttgccagtgtgaggaccacagaggactcaaaggacag
tgtgcggaagctgctccagatcccaagtgtccacagtgtgatgacggcaaatgtcatttt
gatgaagaccagtttccttccgaagcttgcaagccacaggaggaccaacctgtctgcagt
ggccgaggtgtttgtatctgtgggaaatgtttatgtcacaaaaccaagcttggaagagtg
tatggccaatactgtgagaaggatgacttctcttgtccctatctccatggagatgtgtgt
tctggacatggggagtgcgaaggtggcagatgccagtgctttaacggctgggaaggggat
cggtgtcagtgtccatcagcctcagcacagcactgtgtcaactccaagggccaagtttgc
agcgggagaggcacctgcgtttgtggcaggaattgtctacagtgccttcaccctcacaat
ctgtctcaagctgttcttgatcagtgtaaagcctcctgtgctgtcatggaacaacatcct
gtggcccaaacatcagagtgtttatctggcccaagctatctgcgaatatttttcatcata
ttcatagtgacattcttgattgggttgcttaaagttcttatcattagacaagtgatacta
cagtggaatagtaataaaataaagtcctcatcagattacagagtgtctgcttccaaaaag
gataaactgattctgcaaagtgtttgcacgagagctgtaacctaccgacgagaaaagcct
gaggaaataaaaatggatatcagcaaactaaacgcccaggaggctttcaggtgcaacttc
taa

DBGET integrated database retrieval system