KEGG   Rattus norvegicus (rat): 363275Help
Entry
363275            CDS       T01003                                 

Gene name
Eif4e2, Eif4el3
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 2
  KO
K03259  translation initiation factor 4E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno03013  RNA transport
rno04066  HIF-1 signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04211  Longevity regulating pathway
rno04910  Insulin signaling pathway
Module
rno_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    363275 (Eif4e2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    363275 (Eif4e2)
   04151 PI3K-Akt signaling pathway
    363275 (Eif4e2)
   04150 mTOR signaling pathway
    363275 (Eif4e2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    363275 (Eif4e2)
  Aging
   04211 Longevity regulating pathway - mammal
    363275 (Eif4e2)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    363275 (Eif4e2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     363275 (Eif4e2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     363275 (Eif4e2)
Translation factors [BR:rno03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    363275 (Eif4e2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 363275
NCBI-ProteinID: NP_001102278
RGD: 1307790
Ensembl: ENSRNOG00000019634
UniProt: D4A174
Position
9q35
AA seq 174 aa AA seqDB search
MMTVETMIRMKKTAHRKMVRRKKQTEIRARVVEQFWKFYSHMVRPGDLTGHSDFHLFKEG
IKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDI
ISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKYVLGGLGGTGP
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagtggagaccatgatcagaatgaagaaaacagcacacagaaagatggtgaga
aggaaaaaacagaccgagataagagccagagtggtggaacagttctggaagttttacagc
cacatggtccgtcccggggacctgacaggccacagtgactttcatctctttaaagaagga
atcaaacctatgtgggaggatgatgcaaataaaaatgggggcaagtggatcattcgactc
cggaagggcttagcttcccgctgctgggagaatctcatcctggccatgctcggggaacag
ttcatggttggggaggagatctgcggggctgtggtctctgtccgcttccaggaggacatt
atttctatatggaataagactgccagcgaccaagcaaccacagcccgaatccgggacact
cttcggcgcgtgcttaacctacctcccaacaccattatggaatacaaaactcacaccgac
agcatcaagtacgtgttggggggtttgggggggacaggtccctga

DBGET integrated database retrieval system