KEGG   Rattus norvegicus (rat): 363275Help
Entry
363275            CDS       T01003                                 

Gene name
Eif4e2, Eif4el3
Definition
eukaryotic translation initiation factor 4E family member 2
Orthology
K03259  
translation initiation factor 4E
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:rno03013]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:rno04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:rno04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:rno04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q35
AA seq 174 aa AA seqDB search
MMTVETMIRMKKTAHRKMVRRKKQTEIRARVVEQFWKFYSHMVRPGDLTGHSDFHLFKEG
IKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDI
ISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKYVLGGLGGTGP
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagtggagaccatgatcagaatgaagaaaacagcacacagaaagatggtgaga
aggaaaaaacagaccgagataagagccagagtggtggaacagttctggaagttttacagc
cacatggtccgtcccggggacctgacaggccacagtgactttcatctctttaaagaagga
atcaaacctatgtgggaggatgatgcaaataaaaatgggggcaagtggatcattcgactc
cggaagggcttagcttcccgctgctgggagaatctcatcctggccatgctcggggaacag
ttcatggttggggaggagatctgcggggctgtggtctctgtccgcttccaggaggacatt
atttctatatggaataagactgccagcgaccaagcaaccacagcccgaatccgggacact
cttcggcgcgtgcttaacctacctcccaacaccattatggaatacaaaactcacaccgac
agcatcaagtacgtgttggggggtttgggggggacaggtccctga

DBGET integrated database retrieval system