KEGG   Rattus norvegicus (rat): 363287Help
Entry
363287            CDS       T01003                                 

Gene name
Hdac4
Definition
histone deacetylase 4 (EC:3.5.1.98)
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    363287 (Hdac4)
  Substance dependence
   05034 Alcoholism
    363287 (Hdac4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    363287 (Hdac4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     363287 (Hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q36
AA seq 1077 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPAAVPMDLRLDHQFSLP
LEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAM
KHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLN
KKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFPL
RKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVATALKKRPLDVTDSACSSAPGSGPS
SPNSSSGNVSTENGIAPTVPSTPAETSLAHRLVTREGSVAPLPLYTSPSLPNITLGLPAT
GPAAGAAGQQDAERLALPALQQRISLFPGTHLTPYLSTSPLERDGGAAHNPLLQHMVLLE
QPPTQTPLVTGLGALPLHTQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLV
IQQQHQQFLEKHKQQFQQQQLHLSKMISKPSEPPRQPESHPEETEEELREHQALLDEPYL
DRLPGQKEPSLAGVQVKQEPIESEEEEVEATREAEPSQRPATEQELLFRQQALLLEQQRI
HQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLM
LKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLL
YGTNPLNRQKLDSSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVAT
GELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGT
QQAFYNDPNVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEY
LAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGR
IVLALEGGHDLTAICDASEACVSALLGNELEPLPEKVLHQRPNANAVHSMEKVMGIHSEY
WRCLQRLSPTVGHSLIEAQKCENEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagcctgtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggacgtggctacagcgctgcctctg
caggtggcccctgcagcagtacccatggacctgcgcttggaccaccagttctcactgccc
ttggaacctgcactgcgggagcagcaactgcagcaggaactcctagcactgaagcagaag
cagcagatccagcggcagatcctcattgcagagttccagcgtcagcatgagcagttgtcc
cgacagcatgaggcacagctgcatgaacatatcaagcagcagcaggagatgctggccatg
aagcaccagcaggagctgctggagcaccagcggaaactggagcggcaccggcaagagcag
gagctggagaagcagcaccgtgagcagaagctgcagcagctcaagaacaaggagaagggc
aaagagagtgctgtggcgagcacagaggtgaagatgaagctgcaggagtttgttctcaac
aagaagaaggctctggcccaccggaacctgaaccactgcatgtccagcgacccccgctac
tggtatgggaagacacagcacagctcccttgaccagagctctccaccccagagtggggtg
tcagcctcctacaaccaccctgtcttgggaatgtacgacgccaaagatgacttccctctt
aggaaaacagcttctgaacctaacctgaaattacggtcaaggcttaagcagaaagtagct
gagagacggagcagccccctgctgcgcaggaaagatggccctgtggccactgctctaaaa
aagcgacccctggatgttacagactccgcatgtagcagcgcccctggctccggtcccagc
tcccccaatagcagctctggcaacgtcagcaccgagaatggcattgcacccaccgtgccc
agcactccagctgagacgagcttggcacacagacttgtgactcgagaaggctctgttgcc
ccacttcctctctatacatcaccatccttgcccaacatcaccctgggacttcctgccact
ggccctgctgctggtgcagcaggccagcaggatgctgagaggcttgctctcccagccctc
cagcagcgaatctccttgttccctgggacccacctcaccccatacctgagcacctcgccc
ctggagcgggacggtggagcagctcacaaccccctcctgcagcacatggtcctgctggag
cagccacccacccagacgccccttgtcacaggcctgggggcactgcccctccacacacag
tccctggttggtgcggacagggtgtccccatccattcacaagctgcggcagcaccgacct
ctggggcgcacgcagtcagcacccctgccgcagaacgcacaggccctgcagcacctggtg
atccagcagcagcaccagcagtttctggagaagcacaagcaacagttccagcagcagcag
ctgcacctcagcaagatgatttctaaacccagtgagccacctcggcagcctgagagccac
ccggaggagacagaggaggagctccgtgaacaccaggccttgctggatgagccctaccta
gatcggctccctgggcagaaggagccctccttagctggtgtgcaggtgaagcaggagccc
atcgagagtgaggaggaagaagtagaggccactcgagaggcggaacccagccagcgccca
gccactgaacaggagcttctctttagacagcaagctcttctgctggagcagcagaggatc
caccagttaaggaactaccaggcatctatggaggctgctggcatccctgtgtcatttggc
agccacagacctctgtctcgcgcacagtcctccccagcatctgccaccttccccatgtca
gtccaggagccccccaccaaaccaaggttcaccacaggccttgtgtatgacacactcatg
ttgaagcaccagtgcacctgtgggaacaccaacagccacccggagcatgctgggaggatc
cagagcatctggtcccgcctgcaggagactggcctccgtggcaagtgtgagtgcatccgc
ggacgcaaggccacactggaagagctgcagacagtgcactcggaggcccacacactcctc
tatggcacaaaccctctcaacagacagaaactggacagctcgctgacctccgtgtttgtc
aggcttccttgtggtggtgttggggtggatagtgataccatatggaatgaggtgcactcg
tctggggcagcccgcctggctgtaggctgtgtagtggagctggtcttcaaggtggccacg
ggagagctaaagaatggctttgctgtggttcgtcccccaggacaccatgccgaggagagt
acacccatgggtttctgctactttaattctgtggcaattgcagccaaacttctccagcag
aggttgaatgtgagcaagatcctcattgtagactgggatgtgcaccatgggaatgggacc
cagcaggccttctacaatgaccccaatgttctctacatgtccctgcaccgctatgacgat
gggaacttcttcccaggaagtggagcaccagatgaggtgggcacagggccaggcgtgggt
ttcaatgtcaacatggccttcacgggtggcctcgatccccccatgggagacgccgagtac
ctggcagccttcagaacggtggtcatgccaatcgcaaatgagtttgccccagatgtggta
ctggtgtcctcgggcttcgatgctgtggagggccaccccacacctcttggagggtacaat
ctctctgccaaatgtttcgggtacttgacaaaacagctgatgggcttagctggtggccgg
atcgtgctggccctggagggaggccatgacctgacagccatctgtgatgcttctgaagca
tgtgtttctgctctgctgggaaatgagcttgagcctctgccagaaaaggttctacatcag
agacccaatgccaatgccgtccactccatggagaaagtgatgggcatccacagtgagtac
tggcgctgcctgcagcgtttgtcccccactgtggggcactctctgattgaggcgcagaag
tgtgagaatgaagaagctgagacagtcaccgccatggcctcgctgtctgtaggcgtcaaa
cctgctgagaagagatctgaggaggagcccatggaggaggagccaccactgtag

DBGET integrated database retrieval system