KEGG   Rattus norvegicus (rat): 363287Help
Entry
363287            CDS       T01003                                 

Gene name
Hdac4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04371  Apelin signaling pathway
rno05034  Alcoholism
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    363287 (Hdac4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    363287 (Hdac4)
  Substance dependence
   05034 Alcoholism
    363287 (Hdac4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    363287 (Hdac4)
   05165 Human papillomavirus infection
    363287 (Hdac4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     363287 (Hdac4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     363287 (Hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 363287
NCBI-ProteinID: NP_445901
RGD: 619979
Ensembl: ENSRNOG00000020372
UniProt: Q99P99
Position
9q36
AA seq 1077 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPAAVPMDLRLDHQFSLP
LEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAM
KHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLN
KKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFPL
RKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVATALKKRPLDVTDSACSSAPGSGPS
SPNSSSGNVSTENGIAPTVPSTPAETSLAHRLVTREGSVAPLPLYTSPSLPNITLGLPAT
GPAAGAAGQQDAERLALPALQQRISLFPGTHLTPYLSTSPLERDGGAAHNPLLQHMVLLE
QPPTQTPLVTGLGALPLHTQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLV
IQQQHQQFLEKHKQQFQQQQLHLSKMISKPSEPPRQPESHPEETEEELREHQALLDEPYL
DRLPGQKEPSLAGVQVKQEPIESEEEEVEATREAEPSQRPATEQELLFRQQALLLEQQRI
HQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLM
LKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLL
YGTNPLNRQKLDSSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVAT
GELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGT
QQAFYNDPNVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEY
LAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGR
IVLALEGGHDLTAICDASEACVSALLGNELEPLPEKVLHQRPNANAVHSMEKVMGIHSEY
WRCLQRLSPTVGHSLIEAQKCENEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagcctgtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggacgtggctacagcgctgcctctg
caggtggcccctgcagcagtacccatggacctgcgcttggaccaccagttctcactgccc
ttggaacctgcactgcgggagcagcaactgcagcaggaactcctagcactgaagcagaag
cagcagatccagcggcagatcctcattgcagagttccagcgtcagcatgagcagttgtcc
cgacagcatgaggcacagctgcatgaacatatcaagcagcagcaggagatgctggccatg
aagcaccagcaggagctgctggagcaccagcggaaactggagcggcaccggcaagagcag
gagctggagaagcagcaccgtgagcagaagctgcagcagctcaagaacaaggagaagggc
aaagagagtgctgtggcgagcacagaggtgaagatgaagctgcaggagtttgttctcaac
aagaagaaggctctggcccaccggaacctgaaccactgcatgtccagcgacccccgctac
tggtatgggaagacacagcacagctcccttgaccagagctctccaccccagagtggggtg
tcagcctcctacaaccaccctgtcttgggaatgtacgacgccaaagatgacttccctctt
aggaaaacagcttctgaacctaacctgaaattacggtcaaggcttaagcagaaagtagct
gagagacggagcagccccctgctgcgcaggaaagatggccctgtggccactgctctaaaa
aagcgacccctggatgttacagactccgcatgtagcagcgcccctggctccggtcccagc
tcccccaatagcagctctggcaacgtcagcaccgagaatggcattgcacccaccgtgccc
agcactccagctgagacgagcttggcacacagacttgtgactcgagaaggctctgttgcc
ccacttcctctctatacatcaccatccttgcccaacatcaccctgggacttcctgccact
ggccctgctgctggtgcagcaggccagcaggatgctgagaggcttgctctcccagccctc
cagcagcgaatctccttgttccctgggacccacctcaccccatacctgagcacctcgccc
ctggagcgggacggtggagcagctcacaaccccctcctgcagcacatggtcctgctggag
cagccacccacccagacgccccttgtcacaggcctgggggcactgcccctccacacacag
tccctggttggtgcggacagggtgtccccatccattcacaagctgcggcagcaccgacct
ctggggcgcacgcagtcagcacccctgccgcagaacgcacaggccctgcagcacctggtg
atccagcagcagcaccagcagtttctggagaagcacaagcaacagttccagcagcagcag
ctgcacctcagcaagatgatttctaaacccagtgagccacctcggcagcctgagagccac
ccggaggagacagaggaggagctccgtgaacaccaggccttgctggatgagccctaccta
gatcggctccctgggcagaaggagccctccttagctggtgtgcaggtgaagcaggagccc
atcgagagtgaggaggaagaagtagaggccactcgagaggcggaacccagccagcgccca
gccactgaacaggagcttctctttagacagcaagctcttctgctggagcagcagaggatc
caccagttaaggaactaccaggcatctatggaggctgctggcatccctgtgtcatttggc
agccacagacctctgtctcgcgcacagtcctccccagcatctgccaccttccccatgtca
gtccaggagccccccaccaaaccaaggttcaccacaggccttgtgtatgacacactcatg
ttgaagcaccagtgcacctgtgggaacaccaacagccacccggagcatgctgggaggatc
cagagcatctggtcccgcctgcaggagactggcctccgtggcaagtgtgagtgcatccgc
ggacgcaaggccacactggaagagctgcagacagtgcactcggaggcccacacactcctc
tatggcacaaaccctctcaacagacagaaactggacagctcgctgacctccgtgtttgtc
aggcttccttgtggtggtgttggggtggatagtgataccatatggaatgaggtgcactcg
tctggggcagcccgcctggctgtaggctgtgtagtggagctggtcttcaaggtggccacg
ggagagctaaagaatggctttgctgtggttcgtcccccaggacaccatgccgaggagagt
acacccatgggtttctgctactttaattctgtggcaattgcagccaaacttctccagcag
aggttgaatgtgagcaagatcctcattgtagactgggatgtgcaccatgggaatgggacc
cagcaggccttctacaatgaccccaatgttctctacatgtccctgcaccgctatgacgat
gggaacttcttcccaggaagtggagcaccagatgaggtgggcacagggccaggcgtgggt
ttcaatgtcaacatggccttcacgggtggcctcgatccccccatgggagacgccgagtac
ctggcagccttcagaacggtggtcatgccaatcgcaaatgagtttgccccagatgtggta
ctggtgtcctcgggcttcgatgctgtggagggccaccccacacctcttggagggtacaat
ctctctgccaaatgtttcgggtacttgacaaaacagctgatgggcttagctggtggccgg
atcgtgctggccctggagggaggccatgacctgacagccatctgtgatgcttctgaagca
tgtgtttctgctctgctgggaaatgagcttgagcctctgccagaaaaggttctacatcag
agacccaatgccaatgccgtccactccatggagaaagtgatgggcatccacagtgagtac
tggcgctgcctgcagcgtttgtcccccactgtggggcactctctgattgaggcgcagaag
tgtgagaatgaagaagctgagacagtcaccgccatggcctcgctgtctgtaggcgtcaaa
cctgctgagaagagatctgaggaggagcccatggaggaggagccaccactgtag

DBGET integrated database retrieval system