KEGG   Rattus norvegicus (rat): 363445Help
Entry
363445            CDS       T01003                                 

Gene name
Usp9x, RGD1560056
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     363445 (Usp9x)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   363445 (Usp9x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq13
AA seq 2547 aa AA seqDB search
MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQI
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLAQDWFPLLELLAMALNP
HCKFHIYNGTRPCESVSSSVQLPEDELFARSPDPRSPKGWLVDLLNKFGTLNGFQILHDR
FINGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDEELKKEAKN
EAKNDALSMIIKSLKSLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGSSEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLATYMESMRLYGRDNEDYDPQTVRVGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
SNDDIASRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAVRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSFIVRFPNQGRQVD
DLEVWSHTNDTIGSVRRCILNRIKANVAHTKIELFVGGELIDPGDDRKLIGQLNLKDKSL
ITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHPRYISF
LWQVADLGSSLNMPPLRDGARVLMKLMPPDSTTIEKLRAICLDHAKLGESSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPAGAPLADDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMTSVNQVTHDQAVVLQS
ALQSIPNPSSECMLRNVSVRLAQQISDEASRYMPDICVIRAIQKIIWTSGCGGLQLVFSP
NEEVTKIYEKTNAGNEPDLEDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLL
LHCHSKTVRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLGSTARERAKHSGDYFTLLR
HLLNYAYNSNINVPNAEVLLNNEIDWLKRIRDDVKRTGETGVEETILEGHLGVTKELLAF
QTPEKKFHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCGSPATINA
GFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGY
PQQFEDKPPLSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNVNPESQLIQQNEQSESEKAGS
TKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKNQC
FGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDTIDHDDEVIRYISEIAITTRPHQ
IVMPSAIERSVRKQNVQFMHNRMQYSLEYFQFMKKLLTCNGVYLNPPPGQDHLSPEAEEI
TMISIQLAARFLFTTGFHTKKIVRGSASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRF
SEYLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAV
LNLLRREVSEHGRHLQQYFNLFVMYANLGVAEKTQLLKLSVPATFMLVSLDEGPGPPIKY
QYAELGKLYSVVSQLIRCCNVSSRMQSSINGNPSLPNPFGDPNLSQPIMPIQQNVVDILF
VRTSYVKKIIEDCSNSDETVKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLL
LQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCPV
AYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERS
HSARMTLAKACELCPEEEPDDQDAPDEHESPPPEDAPLYPHSPGSQYQQPYTGPAAHHMN
NPQRTGQRAQENYEGSEEVSPPQTKDQ
NT seq 7644 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgactcgtggctctccagttggagggaatgacaaccagggccaagctcct
gatggacagtctcagccccccctccaacagaatcagacttcatcgcctgattcatccaat
gaaaattcccctgcaactcctcctgatgagcaaggccaaggtgatgctcctccccagatt
gaagatgaggaacctgcatttccacacactgacctggcaaagttagatgatatgatcaac
aggcctcgctgggtcgttccagttttgccgaaaggggaattagaagtgcttttagaagct
gctattgatcttagtaagaaaggccttgatgtcaaaagtgaagcatgtcagagatttttc
cgagatgggctaacaatctcattcacaaaaatccttacagatgaagcagtgagtggctgg
aagtttgaaattcatagatgtattattaacaatactcatcgcctggtggagctgtgtgtg
gctaagttagcccaagactggtttccacttctagaacttcttgccatggccttaaatcct
cattgcaaattccatatctacaatggtacacgtccctgcgagtcagtgtcctcaagtgtt
cagttgcctgaagatgaactctttgctcgttctccagaccctcgatcaccaaaaggttgg
ctagtggatctcctcaacaaatttggcactttaaatggattccagatactgcatgatcgt
tttattaatggatcagcattaaatgttcagataattgcagcccttattaaaccatttgga
cagtgctatgagtttcttactcttcacacggtgaaaaaatactttcttccaataatagaa
atggttccacagtttttagaaaacttaactgatgaagagctgaagaaagaagcaaagaat
gaagccaaaaatgatgctctctcaatgattattaaatcattgaagagtttagcttcacga
gttcctggacaggaagaaactgtaaagaacttagaaatatttaggttaaaaatgatactt
agattattgcaaatttcttccttcaatggaaagatgaatgcactgaatgaggttaataag
gtgatttccagtgtgtcatactatacccatcggcatggcagttctgaggaagaagagtgg
ctcacagcagagaggatggctgaatggatacagcagaacaatattttatcaatagtttta
cgagatagtcttcatcaaccacagtatgtagagaaactagaaaagattcttcgctttgtc
ataaaagaaaaagctctgaccttgcaagatcttgataatatctgggcagcacaggcaggg
aaacatgaagccatcgtaaagaatgtccatgatctactggccaaattggcatgggatttt
tctcctgaacaacttgatcatctttttgattgctttaaggccagttggacaaatgcaagt
aaaaagcaacgtgaaaagctccttgagctgattcgtcgtcttgcagaagatgataaagat
ggtgtgatggcacataaagtgttgaaccttctgtggaatctagctcacagtgatgatgtg
cctgtggatatcatggacttggctctcagtgctcacatcaaaatactagattatagttgc
tcccaggaccgggacacacaaaagatccagtggatagatcgcttcatagaagaacttcgc
acaaatgacaagtgggtcattcctgcactgaaacaaattagagaaatttgcagtttgttt
ggtgaagcacctcaaaatttgagtcaaactcagagaagtccccatgtattttatcgccat
gatttaatcaatcaacttcagcacaatcatgccctagttactttggtagcagaaaacctt
gcaacttacatggaaagcatgagactgtatggcagagacaatgaagactatgacccacaa
actgtgagagtgggaagtagatatagtcatgttcaagaagtccaagaacgtcttaacttt
cttagatttttattgaaggatggccagctatggctgtgtgctcctcaggcaaaacaaata
tggaagtgcttagcagagaatgcggtttatctttgtgaccgtgaagcctgctttaagtgg
tattccaaattaatgggagatgaaccagacttagatcctgatatcaataaggacttcttt
gaaagtaatgtgcttcagcttgatccttcactattaactgaaaatggaatgaaatgtttt
gagagattcttcaaagctgtgaattgtcgagaaggaaaactagtagcaaaaagaagagcc
tatatgatggatgatttggaattgataggattagactatctttggagggttgtaattcag
agtaatgatgatattgccagccgagctattgatctcctcaaagagatatacacaaacctt
ggtccaagactgcaggtcaatcaggtggtgatccatgaagacttcattcagtcttgcttt
gatcgtttgaaagcctcttatgacacgttgtgtgttttggatggtgacaaagacagtatt
aattgtgcaagacaggaagctgttcgaatggtccgagtattaactgttttaagagaatat
ataaatgaatgtgacagtgattatcatgaagaaagaacaattttgcctatgtcaagagct
ttccgtggtaaacacctctcttttatagttcggtttccaaaccagggcagacaagtagat
gacttggaagtttggtctcatacaaatgataccattggttcagttcgacgatgtatacta
aatcgcattaaagccaatgtagctcatacaaaaattgaactctttgtgggtggtgagctt
attgatcctggagatgacagaaagttgattggacaattaaacctaaaagataaatcacta
attacagccaaacttacacaaatcagctccaatatgccgtcaagtcctgatagctcctct
gattcctcaactggatctcctggaaaccatggtaatcattacagtgatggtcccaaccca
gaggtagaaagctgtttgcctggagtgataatgtcacttcatcccagatacatctctttc
ctttggcaagttgcagacttagggagcagcctaaatatgccccctcttagagatggagca
agagttcttatgaaacttatgccgccagatagtacaacaatagaaaaattaagagctatt
tgtttagatcatgccaaacttggagaaagcagccttagtccatctcttgactcacttttc
tttggtccttcagcctcacaagtgctatacctaacagaggtagtctatgccctgttaatg
cctgctggtgcacccctggctgatgactcctctgattttcagtttcacttcttgaaaagt
ggtggtttgccccttgttctgagtatgctaaccagaaataacttcctaccaaatgctgat
atggaaactcgaaggggtgcctacctcaatgctcttaaaatagccaaactgttactaact
gccattggctatggccatgttcgggctgtggcagaagcatgtcagccaggtgtagaaggc
gtgaatcctatgacatcggtcaaccaagtaactcatgatcaagcagtggtgctacaaagt
gcccttcagagcattcctaacccatcatctgaatgcatgcttagaaacgtgtctgttcgt
cttgctcagcagatttctgatgaggcttcaagatatatgcctgatatttgtgtaattaga
gctatacaaaagattatttggacatcaggatgtgggggattacaactggtattcagccca
aatgaggaagtcacaaaaatttatgagaagaccaatgcaggcaatgagccagaccttgaa
gatgaacaggtttgctgtgaggcattggaagtgatgacactgtgtttcgccctgattcca
acagccttagatgctctaagtaaagaaaaggcttggcagacatttattattgacttactg
ttacactgtcacagcaaaactgtccgtcaagtagcacaggaacaattcttcttaatgtgc
accagatgttgcatgggacacaggcctctacttttcttcattactctactctttactgtt
ttggggagcacagccagagagagggctaaacattcaggcgactactttactcttttaagg
catcttcttaattacgcttacaacagtaacattaatgtacccaatgctgaagttcttcta
aataatgaaattgattggcttaaaagaattagggatgatgttaaaagaacaggtgaaaca
ggcgttgaagagacaatcttagaaggacaccttggggttacaaaggagctactggctttt
cagacccctgagaaaaagtttcatattggttgtgaaaaggggggtgctaatctcattaaa
gaattaatcgacgatttcatctttcctgcatccaatgtttacctccagtatatgagaaat
ggagaactccctgctgagcaggccattcctgtctgtggttcaccagccacaattaatgct
ggttttgagttacttgtagcattagctgttggctgtgtaaggaacctcaaacagatagta
gattctttgactgaaatgtattacattggtacagcaataactacttgtgaggcacttact
gagtgggaatacctgccacctgttggaccccgtccaccaaaaggatttgtggggctgaaa
aatgctggtgctacttgttacatgaattctgtgattcagcaactctatatgattccctct
atcaggaacggtattcttgcaattgaaggcacaggtagtgatgtagatgatgatatgtct
ggggatgagaagcaggacaatgagagcaatgttgatcccagggatgatgtgtttggatat
cctcaacaatttgaagacaaaccaccactgagtaaaacagaagatagaaaagagtacaat
attggtgttctaagacaccttcaagttatctttggccatttagctgcttctcgactacag
tactatgtgcccagaggattttggaaacagttcaggctttggggtgagcctgttaatctt
cgtgaacaacatgatgctttagagttctttaattcattggtggatagtttagatgaagct
ttaaaagccttagggcatccagctatgctaagtaaagtcttgggaggttccttcgctgat
cagaaaatttgtcaaggctgcccacataggtatgaatgtgaagaatcttttacgactctg
aatgtagacattagaaaccaccaaaatcttcttgattctttggaacagtatgtcaaagga
gatttactagaaggggcaaatgcttatcattgtgaaaaatgcaataaaaaggttgatact
gtaaagcgcttgctaattaaaaagttgcctcctgttcttgctatccaactaaaacgattc
gattatgactgggaaagagaatgtgcaatcaagttcaatgattactttgagtttcctcga
gagttagacatggagccgtacacagttgcaggtgttgctaaactagagggagataatgtc
aacccagaaagtcagctgatacaacagaatgagcagtctgaaagcgaaaaagccggaagc
acaaaatacagacttgtgggtgtgcttgtacacagtggtcaagcaagtgggggacattac
tattcttacatcattcagaggaatggaggagatggtgaaaaaaatcgttggtataaattt
gatgatggagatgtaacagagtgtaaaatggatgatgatgaagaaatgaaaaaccagtgt
tttggtggcgagtacatgggagaagtgtttgatcacatgatgaagcgcatgtcgtacagg
cggcagaaaaggtggtggaatgcatatatacttttttatgaaagaatggatacgatagat
catgatgatgaggtgataagatacatatcagagattgctatcaccacaaggccccatcag
attgttatgccatcggccattgaaagaagtgtgcggaagcagaatgtccaattcatgcat
aaccgaatgcagtacagtttggaatattttcagtttatgaaaaagctacttacatgtaat
ggtgtttatttaaaccctccaccagggcaagatcacctgtctcctgaagcagaagaaatc
actatgattagtattcagcttgctgctaggttcctttttactacaggatttcacacaaag
aaaatagtccgaggatccgccagtgattggtatgatgcattgtgtattctcctccgtcac
agcaagaatgtgcggttttggtttgctcacaatgtgctttttaatgtttcaaatcgattc
tctgagtaccttttggaatgccctagtgcagaagtgagaggtgcatttgctaaacttata
gttttcattgcacacttttccttacaagatgggccttgtccttcaccttttgcatctcct
ggaccttctagtcaggcttatgataacttaagtttgagtgaccacctactaagagcagta
ctaaatctcttgaggagggaggtttcagagcatggacgtcatttacagcagtatttcaac
ttgtttgtaatgtatgccaatttaggagtggcagagaaaacacagctgctcaaactgagt
gtacctgctacctttatgcttgtgtccttagatgaaggtcctggtcctccaattaaatat
cagtatgctgaattaggcaaattatactccgtagtgtcacagttaatccgctgttgcaat
gtctcttcaagaatgcagtcttcaatcaatggtaatccttctcttccaaatccttttggt
gatcctaatttatcacaacctataatgccaattcaacaaaatgtggtagacattttattt
gtgagaacaagttatgtgaagaaaattattgaagactgcagtaactctgatgagaccgtc
aaattgcttcgcttttgctgctgggagaatcctcagttctcatctactgtcctgagtgaa
cttctttggcaggttgcgtattcctatacttacgaactccggccctatttggatctgctt
ttacaaatcttactgattgaagactcctggcagactcacagaattcataatgcccttaaa
ggaattccagatgaccgagatgggctgtttgacacaattcagcgttctaagaatcactat
caaaaaagagcataccaatgtataaaatgtatggtagccctctttagcagttgtcctgtg
gcttaccaaatcctgcagggcaatggagatcttaaaaggaaatggacctgggcagtagag
tggcttggagatgaactcgaaagaagaccatacactggcaatcctcagtacacttacaac
aactggtctcctccagtgcaaagcaatgaaacatcaaatggctacttcttggagagatca
catagcgctaggatgacacttgcaaaagcttgtgaactctgtcctgaggaggaaccagat
gaccaagatgccccagatgagcatgaatcacctccacctgaagatgccccattatacccc
cattcccctggatctcaatatcagcagccctatacaggcccagccgcacatcacatgaac
aaccctcagagaactggccaacgagcacaagaaaattatgaaggcagtgaagaagtgtcc
ccacctcagaccaaggatcagtga

DBGET integrated database retrieval system