KEGG   Rattus norvegicus (rat): 363494Help
Entry
363494            CDS       T01003                                 

Gene name
Gla
Definition
(RefSeq) galactosidase, alpha
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00561  Glycerolipid metabolism
rno00600  Sphingolipid metabolism
rno00603  Glycosphingolipid biosynthesis - globo and isoglobo series
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    363494 (Gla)
  Lipid metabolism
   00561 Glycerolipid metabolism
    363494 (Gla)
   00600 Sphingolipid metabolism
    363494 (Gla)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    363494 (Gla)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    363494 (Gla)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     363494 (Gla)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-GeneID: 363494
NCBI-ProteinID: NP_001102290
RGD: 1589721
Ensembl: ENSRNOG00000011513
Position
Xq32
AA seq 421 aa AA seqDB search
MAMKLLSGDTPLVCELALRPLALVFWSILGARALDNGLARTPTMGWLHWERFMCNLDCQE
EPDACISEQLFMQMAELMVSDGWRDAGYEYLCIDDCWMAPERDSKGRLQADPKRFPSGIK
HLANYVHSKGLKLGIYADVGKKTCAGFPGSFGSYDIDAQTFADWGIDLLKFDGCHCDSVV
SLANGYKYMSLALNRTGRSIVYSCEWPLYLRPFHKPNYTDIQYYCNHWRNFDDVYDSWES
IKSILAWTVTHQKDIVEVAGPGGWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSN
DLRQISSQAKALLQNEDVIAINQDPLGKQGYCFRKENEIEVWERPLSNLAWAVAVRNLQE
IGGPRFYTIQISSLGRGLACNPGCIITQILPEKVHLGFYEWPLTLKTRINPSGTVLLRLE
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaagcttttgagcggagatacaccgctggtctgtgagcttgcgcttcgcccc
ctggctttagttttctggagcattcttggggccagagcattggacaatggcttggcgcgg
acacctactatgggctggctgcactgggaacgtttcatgtgcaaccttgactgccaagaa
gagcctgatgcctgcataagtgagcaactgttcatgcagatggcagagctcatggtctct
gatggctggagggacgcgggttatgaatacctctgcatagatgactgctggatggctccc
gagagggattcaaagggccggcttcaggcagatcccaagcgctttcctagtgggatcaaa
cacctcgctaattacgtccacagcaaaggcttaaagctagggatttatgcagatgttggc
aagaaaacctgtgcaggtttccctgggagctttggatcctatgacattgatgcccagaca
tttgctgactggggtatagatctgctaaaatttgatggttgtcactgtgacagtgtggta
tccttggcgaatggttacaagtacatgtccttggccttgaacaggactggcagaagtatt
gtgtactcctgtgagtggcctctttatttgagaccctttcataagcctaattatacagat
atccaatattactgcaatcactggagaaattttgatgatgtttatgattcctgggaaagc
ataaagtctatcttggcctggacagtaactcaccagaaggacattgttgaagtcgccgga
ccagggggctggaatgacccagacatgttagtgattggcaactttggcctcagttgggac
cagcaggtaacacagatggccctctgggctatcatggcagctcctctactcatgtccaat
gatctccgacaaatcagctctcaagccaaggctctacttcagaatgaggatgtaattgcc
atcaaccaagaccccttgggcaagcaggggtactgttttagaaaggaaaacgaaattgag
gtttgggaacggccactctcaaacctagcctgggccgtggctgtgagaaacctgcaggag
attggtggacctcgtttttacaccatccagatttcttccctgggtcgaggactagcctgc
aatcctggctgcatcatcactcagattctccctgagaaagtacatctaggcttctatgaa
tggcctttaaccttaaaaactcgaataaatccctcaggtactgttttgcttcggttagaa
agataa

DBGET integrated database retrieval system