KEGG   Rattus norvegicus (rat): 363494Help
Entry
363494            CDS       T01003                                 

Gene name
Gla
Definition
galactosidase, alpha (EC:3.2.1.22)
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    363494 (Gla)
  Lipid metabolism
   00561 Glycerolipid metabolism
    363494 (Gla)
   00600 Sphingolipid metabolism
    363494 (Gla)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    363494 (Gla)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    363494 (Gla)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     363494 (Gla)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
Xq34
AA seq 421 aa AA seqDB search
MAMKLLSGDTPLVCELALRPLALVFWSILGARALDNGLARTPTMGWLHWERFMCNLDCQE
EPDACISEQLFMQMAELMVSDGWRDAGYEYLCIDDCWMAPERDSKGRLQADPKRFPSGIK
HLANYVHSKGLKLGIYADVGKKTCAGFPGSFGSYDIDAQTFADWGIDLLKFDGCHCDSVV
SLANGYKYMSLALNRTGRSIVYSCEWPLYLRPFHKPNYTDIQYYCNHWRNFDDVYDSWES
IKSILAWTVTHQKDIVEVAGPGGWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSN
DLRQISSQAKALLQNEDVIAINQDPLGKQGYCFRKENEIEVWERPLSNLAWAVAVRNLQE
IGGPRFYTIQISSLGRGLACNPGCIITQILPEKVHLGFYEWPLTLKTRINPSGTVLLRLE
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaagcttttgagcggagatacaccgctggtctgtgagcttgcgcttcgcccc
ctggctttagttttctggagcattcttggggccagagcattggacaatggcttggcgcgg
acacctactatgggctggctgcactgggaacgtttcatgtgcaaccttgactgccaagaa
gagcctgatgcctgcataagtgagcaactgttcatgcagatggcagagctcatggtctct
gatggctggagggacgcgggttatgaatacctctgcatagatgactgctggatggctccc
gagagggattcaaagggccggcttcaggcagatcccaagcgctttcctagtgggatcaaa
cacctcgctaattacgtccacagcaaaggcttaaagctagggatttatgcagatgttggc
aagaaaacctgtgcaggtttccctgggagctttggatcctatgacattgatgcccagaca
tttgctgactggggtatagatctgctaaaatttgatggttgtcactgtgacagtgtggta
tccttggcgaatggttacaagtacatgtccttggccttgaacaggactggcagaagtatt
gtgtactcctgtgagtggcctctttatttgagaccctttcataagcctaattatacagat
atccaatattactgcaatcactggagaaattttgatgatgtttatgattcctgggaaagc
ataaagtctatcttggcctggacagtaactcaccagaaggacattgttgaagtcgccgga
ccagggggctggaatgacccagacatgttagtgattggcaactttggcctcagttgggac
cagcaggtaacacagatggccctctgggctatcatggcagctcctctactcatgtccaat
gatctccgacaaatcagctctcaagccaaggctctacttcagaatgaggatgtaattgcc
atcaaccaagaccccttgggcaagcaggggtactgttttagaaaggaaaacgaaattgag
gtttgggaacggccactctcaaacctagcctgggccgtggctgtgagaaacctgcaggag
attggtggacctcgtttttacaccatccagatttcttccctgggtcgaggactagcctgc
aatcctggctgcatcatcactcagattctccctgagaaagtacatctaggcttctatgaa
tggcctttaaccttaaaaactcgaataaatccctcaggtactgttttgcttcggttagaa
agataa

DBGET integrated database retrieval system