KEGG   Rattus norvegicus (rat): 364304Help
Entry
364304            CDS       T01003                                 

Gene name
Rnase1, Rib1
Definition
ribonuclease, RNase A family, 1 (pancreatic) (EC:3.1.27.5)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     364304 (Rnase1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Structure
PDB: 

Jmol
Position
15p14
AA seq 152 aa AA seqDB search
MDMEKYLFPFSLLILVLGWVHLYLGGESRESSADKFKRQHMDTEGPSKSSPTYCNQMMKR
QGMTKGSCKPVNTFVHEPLEDVQAICSQGQVTCKNGRNNCHKSSSTLRITDCRLKGSSKY
PNCDYTTTDSQKHIIIACDGNPYVPVHFDASV
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggatatggagaagtacctctttccgttttcactgcttatattggtgcttggatgggtc
catctttacctgggtggggaatctagggaatcatcggcggataagtttaagaggcagcac
atggacacagagggtccctccaagagcagccccacctactgtaaccagatgatgaagcgc
caggggatgaccaaggggtcatgcaagccagtgaacaccttcgtgcatgaacccttggag
gatgtccaggccatctgctcccagggacaagtgacctgcaagaatgggaggaacaactgc
cacaagagcagctccaccctgcgcatcactgactgccgcctgaagggcagctccaagtat
cccaattgcgactacacaaccactgacagccagaagcacatcatcattgcttgtgacggg
aacccctacgtcccagtccacttcgatgcttccgtgtag

DBGET integrated database retrieval system