KEGG   Rattus norvegicus (rat): 364786Help
Entry
364786            CDS       T01003                                 

Gene name
Itga8, RGD1564327
Definition
integrin, alpha 8
Orthology
K06584  
integrin alpha 8
Organism
rno  Rattus norvegicus (rat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    364786 (Itga8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    364786 (Itga8)
   04514 Cell adhesion molecules (CAMs)
    364786 (Itga8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    364786 (Itga8)
  Cellular commiunity
   04510 Focal adhesion
    364786 (Itga8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    364786 (Itga8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    364786 (Itga8)
   05414 Dilated cardiomyopathy (DCM)
    364786 (Itga8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
17q12.3
AA seq 1062 aa AA seqDB search
MSARTHRGPPENWAPPFACLCCVSAVLGMLWSPVSLAFNLDVDKLTVYSGPEGSYFGYSL
DFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAERSAQCKQIPFDTTNNRKIRV
NGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPNPAKDPVGTCYVAIQNFSAY
AEHSPCRNSNVDPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITVSVADIIANYS
FKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSLQELVAGIPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVGQVY
LYLQVSALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLI
YNGNARGLHSKPSQVLQGIWGSQTIPSGFGFSLRGDADIDKNDYPDLLVGAFGEGKVAVY
RARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVACFSLRVCASIAGQSISNTVALMAE
VQLDFLKQKGAIKRTLFLHNHQSHLIFPFVMRQQKSLHCQDFMVYLRDETEFRDKLSPIN
VSLNYSLDDSTFEDGLEVKPILNHYRENVVTEQAHILVDCGEDNLCVPDLRLSARPDKQE
IIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGLRLLSCEYKMENVT
RMVVCDLGNPMVTGTNFSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSVQINV
TAVAQVEIRGVSHPPQIVLPIHNWEPAEEPHKEEEVGPLVEHIYELHNIGPSTISDSILE
VGWPFSAREEFLLYVFHLQTLGPLQCQTNPEINPQDIKPAASPEDTPELSAFLRNATIPH
LVRKRDVPVVQPHRQSPAKILNCTNIDCLQISCAVGRLGGGESAVLKVRSRLWAHTFLQR
KNDPYALASLVSFEVKKIPYKEQPAKLPAGSTAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDEMTDREQLTSDKTPEA
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgagaacccaccggggtcccccggagaactgggcacctccgttcgcttgtctc
tgttgcgtctcggccgtgctggggatgctgtggtcccccgtgtctctggcgttcaacttg
gacgtagacaagctcacggtgtacagtggccccgagggcagctacttcggctactcgctg
gacttctacatacctgatgcgcgcacagccagtgtcttggtgggggcgcccaaagccaac
actagccagccggatatcgtagaagggggagctgtctactactgtccctggcctgcagag
aggtctgcacagtgcaagcagataccctttgacaccaccaacaacaggaaaatcagagtt
aatggaaccaaagagcctatagaatttaaatcaaaccaatggtttggagccacagtgaga
gctcacaaaggaaaagttgtggcttgtgcccctttatatcactggagaactctgaagcct
aatccagcaaaggacccggttggcacatgctatgtagcaattcagaacttcagtgcttac
gctgagcactcaccctgtcggaacagcaacgttgatcctgaaggccaaggttactgccaa
gccggcttcagtctagacttctataagaatggagaccttatagtgggaggacctggaagc
ttttactggcaaggtcaggtgatcacggtcagtgtagcagacatcattgcaaattactca
ttcaaagacattcttcgaaaactggcagcagaaaagcagacagatgtggctccagcttcc
tatgatgacagctaccttggatattcagttgctgctggagaattcactggggactctctg
caagaattggttgctggaattccaagaggagcacagaactttggatatgtctccatcatt
aactccacagatatgaccttcattcagaattttactggtgagcagatggcatcttatttc
ggatatactgttgtggtatcagatgttaacaatgatggcatggatgacatattggtcggg
gcacctctctttatggagcgagaatttgaaagtaaccctagagaagtgggtcaggtctac
ctgtacctacaagtgagcgccctcctcttccaagacccacaggtccttacgggcacagag
acttttgggagattcggtagttctgtggcccacttgggggacctgaaccaagatggatac
aatgatattgccatcggtgtgccctttgcaggcaaggatcaaagaggtaaagtcctcatt
tacaacggaaacgccagaggcttgcacagcaagccttcccaagttctgcaaggaatatgg
gggtcacagaccatcccttctggattcggcttttctctaagaggagacgcagacatagac
aagaatgattacccagatttacttgtcggggcatttggagaagggaaagtggccgtgtac
agagcaaggccagttgtaacagtggatgcccagcttctgctgcacccaatgattatcaac
cttgaaaataaaacttgccagattccagaattcccgactcctgtggcctgcttttcttta
agagtctgtgcatctatagcaggccagagcatttcaaatacagtagccctgatggccgag
gtgcagttagatttcctgaagcaaaaaggagccatcaaacggaccctcttcctccacaac
caccagtcccacctcatcttccccttcgtgatgaggcagcaaaaatccctccactgccag
gattttatggtttaccttcgagatgaaactgaattccgagataaactgtctccaatcaac
gttagcctgaactacagtttggatgattccacctttgaagatggcctggaagtgaagccg
attttgaaccactacagggagaatgtcgttactgagcaggctcacatcctggtggactgt
ggagaagacaacctctgtgttcctgacttgaggctgtcagctagaccagataagcaggag
ataattattggggatgaaaatcacctaatgctcataatcaatgcaaggaatgaaggagaa
ggagcttacgaagctgaactcttcgtcatgattcccgaagaagcagattacgttgggatc
gagcgcaacaacaagggactgaggctcctgagttgtgagtacaagatggaaaacgtaacc
aggatggtggtgtgtgaccttgggaacccgatggtgactggaacgaatttttctctgggc
ctccgatttgctgttcctcgtcttgagaaaacaaacatgagtattaacttcgatctccaa
atcagaagctccaacaaggacaatcctgacagcaatttcgtgagcgtgcaaatcaacgtc
actgccgtggctcaggtggaaatcagaggagtgtcccaccctccccaaattgttctgccc
atccacaactgggagccagcagaggagccccacaaagaggaggaagtcggtcccctggtt
gaacatatttatgagctgcacaatattggacccagcaccatcagtgacagcattctcgaa
gtgggctggccattctctgcacgggaggagttcctcctctatgtctttcatcttcaaact
ctgggacctctacaatgtcaaacaaatcctgagatcaacccgcaggatataaagcctgct
gcctccccagaggatacccctgagctcagcgccttcttaagaaatgctacaattccccat
cttgtcaggaagagggatgtgccagtggtccagccccacagacagagcccggcaaaaata
ctgaactgtaccaacattgactgcttgcaaatctcgtgtgcagtgggtcgcctgggagga
ggagaaagtgcagttctgaaggtcagatcgagattgtgggcgcacacattcctccagaga
aagaacgacccttatgctcttgcatccctggtgtcctttgaagtcaagaagataccttat
aaagagcagccagcaaaactgccagccgggagcacagcgattaagacatcggttatttgg
gccactccaaatgtctccttctcaattccactgtgggtcataatactagcgatccttctt
ggcttgctggttctggccatcttaactttagctttatggaagtgtggattctttgataga
gcaagacctcctcaggatgaaatgacagacagggaacaactgaccagtgacaagaccccg
gaggcttga

DBGET integrated database retrieval system