KEGG   Rattus norvegicus (rat): 365345Help
Entry
365345            CDS       T01003                                 

Gene name
Cyb5r2, RGD1308421
Definition
cytochrome b5 reductase 2 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rno00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q33
AA seq 276 aa AA seqDB search
MSVKKKDLITLQDPEAKYPLPLIEKEQINHNTRRFRFGLPSPDHVLGLPVGNYVHLLAQI
NNELVIRAYTPVSSDDDQGFVDLIIKIYFKNVHPKYPEGGKMTQYLENMKIGDTILFRGP
TGRLFYNEPGTLLIKTDKTSEPEKKLVHHLGMIAGGTGITPMLQLIRHITKDTSDGTRMS
LLFANQTEEDILLRKELEEVATTHQNQFSLWYTLDRPPSGWEYSSGFITADMIKEHLPPP
GEATLILVCGPPPLIQEAAHPSLEQLGYTKDMIFTY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaagaagaaagatcttatcactttacaggaccctgaagccaagtacccgctg
cccttgattgagaaagagcaaatcaaccacaacaccagaaggttccgatttggactgccc
tcaccagaccatgtcctagggcttcctgtaggtaactatgtccatctcttggcacaaatt
aacaatgaattggtgatcagggcttacacgcctgtctccagtgacgatgatcaaggattt
gtggacttaattataaagatctacttcaaaaatgtgcaccctaagtatcctgaaggagga
aagatgactcagtacttggagaatatgaaaattggggacaccattctttttcgggggcca
acggggcgcctgttctataatgagccagggacccttttaatcaaaacagacaaaacgagt
gagcctgaaaaaaagctggttcatcacctggggatgattgctggaggcacaggcattacg
cccatgctacagctaattcgccacatcaccaaggacaccagcgatgggaccaggatgtcc
ctcctctttgccaaccagacagaagaggatatcttgctgagaaaggagctagaagaagtg
gccacaacgcatcagaaccagttcagcctgtggtataccctggacaggccccccagtggt
tgggagtacagctcaggcttcattactgcagacatgatcaaggagcacctccctcctcct
ggggaggccacactcatcctggtatgtggcccaccacctctgatccaggaggcagctcac
cccagcctggagcagcttggctacaccaaggacatgatttttacctactaa

DBGET integrated database retrieval system