KEGG   Rattus norvegicus (rat): 365842Help
Entry
365842            CDS       T01003                                 

Gene name
Clk2
Definition
(RefSeq) CDC-like kinase 2
  KO
K08823  CDC-like kinase [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     365842 (Clk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CLK family
   365842 (Clk2)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    365842 (Clk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 365842
NCBI-ProteinID: NP_001014276
RGD: 1359711
Ensembl: ENSRNOG00000020500
UniProt: Q5XI98
Position
2q34
AA seq 500 aa AA seqDB search
MPHPRRYHSSERGSRGSYHEHYRSRKHKRRRSRSWSSTSDRTRRRRREDSYHVRSRSSYD
DHSSDRRLYDRRYCGSYRRNDYSRDRGEAYYDTDFRHSYEYHRENSSYRSQRSSRRKPRR
RRRRSRTFSHSSSQHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQC
VDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMC
ISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVN
SDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQ
PCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLD
WDENTSAGRYVRENCKPLRRYLTSEAEDHHQLFDLIENMLEYEPAKRLTLGEALQHPFFA
CLRTEPPNTKLWDSSRDISR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatccccgaaggtaccattcctcagagagaggtagccggggaagttaccacgag
cactatcggagccgaaaacataagcgaagaagaagtcgctcctggtcaagtaccagtgac
cggacaaggcggcggcggagggaggatagctaccatgttcggtctcgaagcagctatgac
gatcattcatctgaccggcggctatacgatcgacgatactgtggcagctacaggcgcaat
gactacagccgggatagaggagaggcctactatgacacagactttcggcattcctatgaa
taccatcgagagaacagcagttaccgaagccagcgcagcagccgccggaaacccagacgg
cggagaagacgtagcagaacattcagccactcatcttcacagcacagcagccggagagcc
aagagtgtagaggacgacgctgagggccacctcatctaccacgtcggggactggctacaa
gagcgatatgaaattgtaagcaccttaggagaagggacctttggccgagttgtacagtgt
gtggaccatcgcaggggcggagcacgagttgccctgaagatcattaagaatgtggagaag
tacaaggaggccgctcgactagaaatcaacgtgctggagaaaatcaatgagaaagatcct
gacaacaagaacctctgtgtccagatgtttgactggtttgactaccatggccacatgtgt
atctcctttgagcttctgggccttagcaccttcgatttcctcaaagacaacaactacctg
ccctaccccatccaccaagtgcgccacatggccttccagctctgccaggccgtcaagttc
ctccatgataacaagttgacacatacggacctcaaacctgaaaatattctgtttgtgaat
tcagactacgaactcacctacaatctagagaagaaacgagatgaacgcagtgtgaagagc
acagctgtgcgggtggtggacttcggcagtgccacctttgaccatgagcaccatagcacc
attgtctccactcgccattaccgagccccagaagtcatcctggagttgggctggtcacag
ccgtgcgacgtgtggagcataggctgtatcatcttcgagtactacgtcggcttcaccctc
ttccagacccatgacaacagagagcatctagccatgatggaaaggatcctgggtcctgtc
ccctctcggatgatcagaaagacaagaaaacagaaatatttttatcggggtcgcctggat
tgggatgagaacacctcagctgggcgctacgtccgtgagaactgcaaaccactacggcgg
tatctgacctcagaggcagaggaccaccaccagctcttcgatctgattgaaaacatgctt
gagtatgaacctgctaagcggctgaccttaggtgaagcccttcagcaccctttcttcgcc
tgccttcggactgagccacccaacaccaagttgtgggactccagtcgggatatcagtcgg
tga

DBGET integrated database retrieval system