KEGG   Rattus norvegicus (rat): 396527Help
Entry
396527            CDS       T01003                                 

Gene name
Ugt1a2, UDPGT_1-2, Udpgt, Ugt1
Definition
UDP glucuronosyltransferase 1 family, polypeptide A2 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    396527 (Ugt1a2)
   00053 Ascorbate and aldarate metabolism
    396527 (Ugt1a2)
   00500 Starch and sucrose metabolism
    396527 (Ugt1a2)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    396527 (Ugt1a2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    396527 (Ugt1a2)
   00860 Porphyrin and chlorophyll metabolism
    396527 (Ugt1a2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    396527 (Ugt1a2)
   00982 Drug metabolism - cytochrome P450
    396527 (Ugt1a2)
   00983 Drug metabolism - other enzymes
    396527 (Ugt1a2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    396527 (Ugt1a2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     396527 (Ugt1a2)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   396527 (Ugt1a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q35-q36
AA seq 533 aa AA seqDB search
MDTGLCAPLRGLSGLLLLLCALPWAEGGKVLVFPMEGSHWLSMRDVVRELHARGHQAVVL
APEVTVHMKGEDFFTLQTYAFPYTKEEYQREILGNAKKGFEPQHFVKTFFETMASIKKFF
DLYANSCAALLHNKTLIQQLNSSSFDVVLTDPVFPCGALLAKYLQIPAVFFLRSVPCGID
YEATQCPKPSSYIPNLLTMLSDHMTFLQRVKNMLYPLTLKYICHLSITPYESLASELLQR
EMSLVEVLSHASVWLFRGDFVFDYPRPIMPNMVFIGGINCVIKKPLSQEFEAYVNASGEH
GIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDL
LGHPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTA
DDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHD
LTWYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggacacaggattgtgtgcaccccttcgaggactctcaggactgctgctcctgctgtgt
gccctgccctgggctgaaggtggaaaggtgctggtgtttcccatggagggcagccactgg
ctgagcatgagggatgtcgtgagggagctccacgcccgaggtcaccaggctgtggtcctg
gctccagaggtgactgtgcacatgaaaggagaggacttcttcaccctccaaacctatgcc
tttccatataccaaggaagaatatcagcgggaaatactgggcaacgctaagaagggcttc
gaaccacaacattttgtgaagactttctttgaaactatggcatctataaaaaagtttttc
gatctctacgcaaattcttgtgcagctctattgcacaataagaccctgatccagcaactg
aattccagttccttcgatgtggtcttaacagaccctgttttcccctgtggagcattactg
gccaagtatctacagattcctgctgtgttttttctgcgctctgttccctgtggcatagac
tatgaggctacacaatgtccgaaaccttcctcttatattccgaacctactcacaatgctt
tctgaccacatgaccttcctgcaaagggtcaagaacatgctgtaccctctgaccttgaag
tacatttgccatttatcaatcactccctatgaaagcctggcctctgagcttttgcagaga
gaaatgtctttagtggaggttctcagtcatgcatctgtgtggctgttccgaggggacttt
gtgtttgactacccgaggcccatcatgcctaatatggtcttcattggaggcataaactgt
gtcatcaagaagcccctctctcaggaatttgaagcctatgtcaacgcctccggagaacat
ggcatcgtggttttctctttgggatccatggtctcagagattccagagaagaaagcgatg
gaaattgctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaact
agaccatcgaaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctg
cttggtcatccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaa
ggaatatgcaatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaac
gccaagcgcatggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgcc
gatgatttggaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatc
atgcgcctctccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttc
tgggtggagtacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgac
ctcacctggtaccagtaccactccttggacgtgattggctttctcctggccatcgtgttg
acggtggtcttcattgtctataaaagttgtgcctatggctgccggaaatgctttggggga
aagggtcgagtgaagaaatcacacaaatccaagacccactga

DBGET integrated database retrieval system