KEGG   Rattus norvegicus (rat): 396551Help
Entry
396551            CDS       T01003                                 

Gene name
Ugt1a3, UDPGT_1-3, Ugt1, Ugt1a4
Definition
UDP glycosyltransferase 1 family, polypeptide A3 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    396551 (Ugt1a3)
   00053 Ascorbate and aldarate metabolism
    396551 (Ugt1a3)
   00500 Starch and sucrose metabolism
    396551 (Ugt1a3)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    396551 (Ugt1a3)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    396551 (Ugt1a3)
   00860 Porphyrin and chlorophyll metabolism
    396551 (Ugt1a3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    396551 (Ugt1a3)
   00982 Drug metabolism - cytochrome P450
    396551 (Ugt1a3)
   00983 Drug metabolism - other enzymes
    396551 (Ugt1a3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    396551 (Ugt1a3)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     396551 (Ugt1a3)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   396551 (Ugt1a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q35
AA seq 531 aa AA seqDB search
MGIQGFLQKLSGLLLLLCALPWAEGGKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAP
EVTVHIKEEDFFTLQTYPVPYTKEEYRHHLLGHLQNFFETEFSLKLVLQRMAAVNNVSTF
YVRSCRGLLHNTALIQSLNSSSFDVVLTDPFFPCGAVLAMYLRVPAVFFLQSMLCELEFE
ATNSPNPSSYIPRLLTLNSDHMSFLDRVKNMLYPVPWMYLCHVNYGSLARLASDLLQREV
SVVEILRHASVWLLRKDFVFYYPRPFMPNMVFIGGINCANRKPLSQEFEAYVNASGEHGI
VVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLG
HPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADD
LENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLT
WYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgggaatccaagggttcctgcagaaactctcaggactgctgctcctgctgtgtgccctg
ccctgggctgaaggtggaaaggtgctggtgtttcccatggagggcagccactggctgagc
atgagggatgtcgtgagggagctccacgcccgaggtcaccaggctgtggtcctggctcca
gaggtgactgtgcacatcaaagaagaggacttcttcaccctccaaacctaccctgttcca
tacaccaaggaagagtacaggcaccacttgctgggccaccttcaaaattttttcgaaact
gaattttctctgaagttagttctacagagaatggcagctgtaaataacgtatcaacattc
tatgtgagatcttgcaggggtctgctgcataacacagctctgatccagagcctgaactcc
agctccttcgatgtggttttaacagatccctttttcccctgtggggcagtgctggccatg
tacctgcgtgttcctgctgtgttttttctgcaatccatgctctgtgaactggaatttgaa
gcaacaaacagtccaaacccttcttcttatattcccaggttactaacattgaattctgac
cacatgagcttcctagacagagtgaagaatatgctttatcctgtgccatggatgtattta
tgccatgttaattatggctctctggcgagacttgcgtcagaccttttgcagagggaggta
tccgtggtagagatcctcagacatgcctctgtatggctgttgagaaaggactttgtgttc
tactaccccaggcccttcatgcccaacatggtcttcattgggggcataaactgtgccaac
aggaagccactgtctcaggaatttgaagcctatgtcaacgcctccggagaacatggcatc
gtggttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaatt
gctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagacca
tcgaaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggt
catccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaata
tgcaatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaag
cgcatggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgat
ttggaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgc
ctctccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtg
gagtacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacc
tggtaccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtg
gtcttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggt
cgagtgaagaaatcacacaaatccaagacccactga

DBGET integrated database retrieval system