KEGG   Rattus norvegicus (rat): 396552Help
Entry
396552            CDS       T01003                                 

Gene name
Ugt1a9, Ugt1a10, Ugt1a11
Definition
UDP glucuronosyltransferase 1 family, polypeptide A9 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    396552 (Ugt1a9)
   00053 Ascorbate and aldarate metabolism
    396552 (Ugt1a9)
   00500 Starch and sucrose metabolism
    396552 (Ugt1a9)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    396552 (Ugt1a9)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    396552 (Ugt1a9)
   00860 Porphyrin and chlorophyll metabolism
    396552 (Ugt1a9)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    396552 (Ugt1a9)
   00982 Drug metabolism - cytochrome P450
    396552 (Ugt1a9)
   00983 Drug metabolism - other enzymes
    396552 (Ugt1a9)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    396552 (Ugt1a9)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     396552 (Ugt1a9)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   396552 (Ugt1a9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
9q35
AA seq 530 aa AA seqDB search
MAPSGCPSSLPLCVCLFLASGFAQAGRLLVVPMDGSHWFTRQMTVEKLLQRGHEVGVVIP
EESWQLGKLVNCTVKTYSIPYTVEDMDREFKHFSYTQWKTPEQSMYSLITGSVKDFLEIT
FSHCRSLFKDKKLVEYLKQSSFDAVFLDPFHVCGLTVAKYLSLPSIIFAKDIFCDNLKEG
AQCPSLPSYVPRLFSKSADTMSFKERLWNHLIYFEERAFCSYYLKTAIEIASEVLQTPVT
LTDLYSPVSIWLLRTDFVFNFPRPVMPNMVFVGGINCFQRKPLSKEFEAYVNASGEHGIV
VFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGH
PKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDL
ENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctccttcaggctgtccatcctcccttcctctgtgtgtgtgtctgttcctggcctct
ggatttgcccaggcaggcaggctgctggtggtgcccatggatgggagccactggttcacc
aggcagatgactgtggagaaactcctccagagagggcatgaggtaggggtagtcatccca
gaggagagttggcagctgggaaaattggtgaattgtacagtgaagacatactcaattcct
tacactgtggaggatatggaccgtgaattcaagcatttttcgtacactcaatggaaaact
ccagaacaaagtatgtattctttaataacaggctcagtcaaagatttcttagaaataaca
ttttcacactgtaggagtttgtttaaggacaagaagttagtggagtacttgaagcagtct
tcttttgatgctgtgtttctggatccttttcacgtgtgtggcttaactgttgccaaatat
ttgtcactgccatcaataatttttgccaaagacatattttgcgacaatcttaaagagggt
gcccagtgcccaagtcttccttcttatgttcctagacttttctcaaaatccgcagacacc
atgagtttcaaggagcgattgtggaaccatcttatctactttgaagaacgtgcattttgc
tcctattatttgaaaactgctatagaaattgcctctgaggttctgcagaccccagtgact
ctgacagacctctacagcccagtgtccatttggttgttacgcactgactttgtgttcaac
ttccccagacctgtgatgcccaacatggtctttgttggtggcatcaactgcttccagagg
aagccactttccaaggaatttgaagcctatgtcaacgcctccggagaacatggcatcgtg
gttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaattgct
gaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagaccatcg
aaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggtcat
ccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaatatgc
aatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaagcgc
atggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgatttg
gaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtggag
tacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacctgg
taccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtggtc
ttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggtcga
gtgaagaaatcacacaaatccaagacccactga

DBGET integrated database retrieval system