KEGG   Rattus norvegicus (rat): 414791Help
Entry
414791            CDS       T01003                                 

Gene name
RT1-CE11
Definition
RT1 class I, locus CE11
Orthology
K06751  
major histocompatibility complex, class I
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocytosis
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Type I diabetes mellitus
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:rno04514]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:rno04144]
Cellular Processes; Transport and catabolism; Phagosome [PATH:rno04145]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:rno04650]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:rno04612]
Human Diseases; Cancers; Viral carcinogenesis [PATH:rno05203]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:rno05320]
Human Diseases; Immune diseases; Allograft rejection [PATH:rno05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:rno05332]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:rno05416]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:rno04940]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:rno05166]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:rno05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:rno05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
20p12
AA seq 367 aa AA seqDB search
MGSRAPHTLLLLLVAALAQTQPRAGSHSLWYFTSALSWPGLGEPRFISVRYVDDTEFVRF
DSGSENPRYEPRAPWMEREGPEYWEQQTRRAKGNQQTFQVNLRTALRYYNQSEDRSHTIQ
RMYGCDMGSDRSLLRGYEQYAYDGRDYIALNEDLKTWTAADVAAQITRNKWDQAGVAERR
RAYLEGTCVKWLRRYLEHGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETRPAGDGTFQKWASVVVALGKEQKYTCLVEHEGLPEPLTQRWEA
PPSTDSNMETNVIYVVVGALVITGAVIIGAVVAVVRKRNTGGTGGDYAPAPGKANPNSSV
SLPDCKA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggggtcaagggcacctcacactctgctcctgctgctggtggccgccctggcccagacc
cagccccgcgcgggctcgcactcgctgtggtatttcacctcggcgctgtcctggcccggc
ctcggggagccccggttcatctctgtccgctatgtggacgacacggagttcgtgcgcttc
gacagcggctctgagaatccgagatacgagccgcgggcgccgtggatggagcgggagggg
ccggagtattgggagcagcagacacggagagccaagggcaaccagcagactttccaagtg
aacctgaggaccgcgctccgctactacaaccagagcgaggaccgctctcacaccatccag
aggatgtatggctgtgacatggggtcggacaggagcctcctccgcgggtatgagcagtac
gcctacgacggccgcgattatatcgccctgaacgaagacctgaagacctggacagcagca
gacgtggctgcgcagatcacccggaacaagtgggatcaggctggtgttgcagagagacgc
agggcctacctggagggcacgtgcgtgaagtggctccgcagatacctggagcacgggaag
gagacgctgctgcgctcagatcccccaaaggcacatgtgacacttcaccccagacctgaa
ggtgatgtgaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtggctcttgggaaggagcagaag
tacacatgccttgtggagcatgaggggctgcctgagccgcttacccagagatgggaggct
cctccatccactgactccaacatggaaaccaatgtcatttatgttgtcgttggagccctg
gtcatcactggagctgtgatcattggagctgtggtggctgttgtgaggaagagaaacaca
ggaggaacaggaggagactacgcccctgctccaggcaaggccaaccccaacagctctgtg
tctctcccagattgtaaagcatga

DBGET integrated database retrieval system