KEGG   Rattus norvegicus (rat): 414791Help
Entry
414791            CDS       T01003                                 

Gene name
RT1-CE11
Definition
RT1 class I, locus CE11
Orthology
K06751  
major histocompatibility complex, class I
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocytosis
Phagosome
Cell adhesion molecules (CAMs)
Antigen processing and presentation
Type I diabetes mellitus
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    414791 (RT1-CE11)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    414791 (RT1-CE11)
   04145 Phagosome
    414791 (RT1-CE11)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    414791 (RT1-CE11)
   04612 Antigen processing and presentation
    414791 (RT1-CE11)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    414791 (RT1-CE11)
  Immune diseases
   05320 Autoimmune thyroid disease
    414791 (RT1-CE11)
   05330 Allograft rejection
    414791 (RT1-CE11)
   05332 Graft-versus-host disease
    414791 (RT1-CE11)
  Cardiovascular diseases
   05416 Viral myocarditis
    414791 (RT1-CE11)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    414791 (RT1-CE11)
  Infectious diseases
   05166 HTLV-I infection
    414791 (RT1-CE11)
   05168 Herpes simplex infection
    414791 (RT1-CE11)
   05169 Epstein-Barr virus infection
    414791 (RT1-CE11)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414791 (RT1-CE11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
20p12
AA seq 367 aa AA seqDB search
MGSRAPHTLLLLLVAALAQTQPRAGSHSLWYFTSALSWPGLGEPRFISVRYVDDTEFVRF
DSGSENPRYEPRAPWMEREGPEYWEQQTRRAKGNQQTFQVNLRTALRYYNQSEDRSHTIQ
RMYGCDMGSDRSLLRGYEQYAYDGRDYIALNEDLKTWTAADVAAQITRNKWDQAGVAERR
RAYLEGTCVKWLRRYLEHGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETRPAGDGTFQKWASVVVALGKEQKYTCLVEHEGLPEPLTQRWEA
PPSTDSNMETNVIYVVVGALVITGAVIIGAVVAVVRKRNTGGTGGDYAPAPGKANPNSSV
SLPDCKA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggggtcaagggcacctcacactctgctcctgctgctggtggccgccctggcccagacc
cagccccgcgcgggctcgcactcgctgtggtatttcacctcggcgctgtcctggcccggc
ctcggggagccccggttcatctctgtccgctatgtggacgacacggagttcgtgcgcttc
gacagcggctctgagaatccgagatacgagccgcgggcgccgtggatggagcgggagggg
ccggagtattgggagcagcagacacggagagccaagggcaaccagcagactttccaagtg
aacctgaggaccgcgctccgctactacaaccagagcgaggaccgctctcacaccatccag
aggatgtatggctgtgacatggggtcggacaggagcctcctccgcgggtatgagcagtac
gcctacgacggccgcgattatatcgccctgaacgaagacctgaagacctggacagcagca
gacgtggctgcgcagatcacccggaacaagtgggatcaggctggtgttgcagagagacgc
agggcctacctggagggcacgtgcgtgaagtggctccgcagatacctggagcacgggaag
gagacgctgctgcgctcagatcccccaaaggcacatgtgacacttcaccccagacctgaa
ggtgatgtgaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtggctcttgggaaggagcagaag
tacacatgccttgtggagcatgaggggctgcctgagccgcttacccagagatgggaggct
cctccatccactgactccaacatggaaaccaatgtcatttatgttgtcgttggagccctg
gtcatcactggagctgtgatcattggagctgtggtggctgttgtgaggaagagaaacaca
ggaggaacaggaggagactacgcccctgctccaggcaaggccaaccccaacagctctgtg
tctctcccagattgtaaagcatga

DBGET integrated database retrieval system