KEGG   Rattus norvegicus (rat): 445442Help
Entry
445442            CDS       T01003                                 

Gene name
Thbs1, TSP-1, Tsp1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04115  p53 signaling pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04350  TGF-beta signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05144  Malaria
rno05165  Human papillomavirus infection
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    445442 (Thbs1)
   04350 TGF-beta signaling pathway
    445442 (Thbs1)
   04151 PI3K-Akt signaling pathway
    445442 (Thbs1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    445442 (Thbs1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    445442 (Thbs1)
  Cell growth and death
   04115 p53 signaling pathway
    445442 (Thbs1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    445442 (Thbs1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    445442 (Thbs1)
   05205 Proteoglycans in cancer
    445442 (Thbs1)
   05219 Bladder cancer
    445442 (Thbs1)
  Infectious diseases
   05165 Human papillomavirus infection
    445442 (Thbs1)
   05144 Malaria
    445442 (Thbs1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    445442 (Thbs1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   445442 (Thbs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC cEGF EGF_3 EGF_CA Laminin_G_3 Laminin_G_2 EGF Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 445442
NCBI-ProteinID: NP_001013080
RGD: 1588455
UniProt: Q71SA3
Position
3q35
AA seq 1170 aa AA seqDB search
MELLRGLGVLFLLHVCGSNRIPESGGDNGVFDIFELIGGARKVPGRRLVKGQDLSSPAFR
IENANLIPPVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNSGQIFSVV
SNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELD
VPIQSIFTRDLANVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGLSCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENRELASELRRPPLCFHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWSPWSLWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQV
CNKQDCPIDGCLSNPCFAGAKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDACF
NHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGRGVEHAMANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAVDIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQAIDEDGHQNNLENCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGLIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDMKYECRDS
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctcaggggactaggcgtcctgttcctgttgcatgtgtgtggaagcaaccgc
attccagagtctgggggagacaatggtgtgttcgacatttttgaactcattggaggtgcc
cgcaaggttccgggtcgccgactggtgaagggccaagatctatccagccccgccttccgg
atcgagaatgccaacctgatcccccctgtgccagatgacaagttccaagacctactggac
gctgtgtgggccgacaaaggcttcatcttcctggcttccttgaggcagatgaagaagact
cggggcacactcctggccgtggaacggaaagacaattctggccagatcttcagtgtggtc
tccaatggcaaagccggcaccctcgatctgagtctgagcctgcccgggaagcagcaagtg
gtgtcagtggaggaagctctcctggccactggccagtggaagagcatcacgctgtttgtc
caagaagacagggcccagctctacattgactgtgacaagatggagagcgcagagctggat
gttcccatccagagcatcttcacaagggatttggccaatgtcgccaggctccgagtcgca
aagggagatgtcaatgacaattttcagggggtgctgcagaatgtgaggtttgtctttgga
accaccccagaagacattctcaggaacaaaggctgctccagttcaaccaacgtccttctc
acccttgacaacaacgtggtgaacggttccagccctgccatccgcaccaactacatcggc
cacaaaacaaaggacctccaagccatctgtggcctctcctgtgacgaactatccagcatg
gtcctggaactgaggggcctgcgtaccatcgtgaccacgctacaggacagcattcgcaaa
gtgacggaagagaacagagagctggctagcgagctgaggcggcctcccctctgcttccac
aatggagtccaatacaggaacaacgaggagtggactgtagatagttgcacagagtgtcac
tgccagaactcagttaccatctgcaaaaaggtgtcctgtcccatcatgccctgctccaat
gccacagttcctgatggtgaatgctgcccacggtgctggcccagtgactctgctgacgat
ggctggtctccctggtctgagtggacctcttgctctgccacctgtggcaatgggattcag
caacgtggtcgctcctgtgacagcctcaacaacagatgtgagggctcttcagtacagacg
aggacctgccacattcaggagtgcgacaaaagatttaaacaggatggtggttggagtcac
tggtccccgtggtcgtcctgttctgtgacctgtggtgacggtgtgatcacgaggatccga
ctctgcaactcccccagcccccagatgaacgggaagccctgtgaaggtgaagctcgggag
accaaagcctgcaagaaggacgcctgcccaatcaatggaggctggagtccctggtcacta
tgggacatctgctctgtcacctgtggaggaggagtacagagacgtagccgactctgcaac
aaccccacaccccagtttggaggcaaagactgtgttggtgatgtgacggaaaatcaagtt
tgcaacaagcaggactgtccgattgatggatgcctgtccaatccctgctttgctggtgcc
aagtgtacgagctatcctgatggtagctggaaatgtggtgcgtgtcctcctggctacagt
ggaaatggtatccagtgcaaagacgtcgacgagtgcaaagaagtgcctgatgcttgcttc
aatcacaacggggaacatcggtgcaagaacacagatcctggctacaactgcctgccctgc
ccaccacgattcaccggctcacagcccttcggcagaggtgtcgaacacgctatggccaac
aaacaggtgtgcaaaccccgaaacccctgcaccgacgggacacacgactgcaacaagaac
gccaagtgcaactacctgggtcactacagcgaccccatgtaccgctgcgagtgcaagcct
ggctatgcaggcaatggcatcatttgcggagaggacacagaccttgacggctggcctaat
gaaaacctggtgtgtgtggccaacgcaacctaccactgcaaaaaggacaactgccccaat
cttcccaattcggggcaggaagactatgacaaggatgggattggcgatgcctgtgatgac
gatgatgacaacgacaagattcctgatgacagggacaactgtccattccattacaaccct
gcccagtatgactatgacagagatgatgtgggagaccgctgtgacaattgcccctacaac
cacaaccctgaccaggcagacacagacaacaatggggagggagatgcctgcgctgtggac
atcgatggggatggaatcctcaatgaacgagacaactgccagtatgtttacaacgtggat
cagagggacacggacatggatggggttggagaccagtgtgacaactgccccctggaacac
aatccagaccagctggactctgactcggaccgcataggggacacctgtgacaacaatcag
gccatcgatgaggatggccatcagaacaaccttgaaaactgtccctatgtgcccaatgcc
aaccaggccgaccacgataaagatggtaaaggagacgcctgtgaccatgacgatgacaac
gacggcatccctgatgacagagacaactgcaggctggtgcccaatcctgaccagaaggac
tctgatggtgatggccgaggcgatgcctgcaaagacgactttgaccatgacaatgtgcca
gacattgatgacatctgtcctgagaatgttgacatcagtgaaaccgatttccgccgattc
cagatgattcctctagatcccaaaggaacctcccaaaatgaccctaactgggttgtccgc
catcagggcaaagaacttgtccagactgtaaactgtgaccctggacttgctgtaggttat
gatgagtttaatgccgtggacttcagtggtaccttcttcatcaacactgagagggatgac
gactatgctggctttgttttcgggtaccagtccagcagccgcttctacgttgtgatgtgg
aaacaagtcacccagtcctactgggacaccaaccccacaagggctcagggatactcaggc
ctgtctgtaaaggttgtaaactccaccactggccccggcgagcacctgcggaatgcactg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgtcacatt
ggctggaaagatttcactgcatacagatggcgtctcagccacaggccaaagaccggtttg
atcagagtggtgatgtatgaaggaaagaaaatcatggctgactcaggacccatctatgac
aaaacctacgctggcggtagactaggcctgttcgtcttctctcaagaaatggtgttcttc
tcggacatgaaatacgagtgccgagactcctaa

DBGET integrated database retrieval system