KEGG   Rattus norvegicus (rat): 493909Help
Entry
493909            CDS       T01003                                 

Gene name
Aox3, Aoh1
Definition
(RefSeq) aldehyde oxidase 3
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00280  Valine, leucine and isoleucine degradation
rno00350  Tyrosine metabolism
rno00380  Tryptophan metabolism
rno00750  Vitamin B6 metabolism
rno00760  Nicotinate and nicotinamide metabolism
rno00830  Retinol metabolism
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    493909 (Aox3)
   00350 Tyrosine metabolism
    493909 (Aox3)
   00380 Tryptophan metabolism
    493909 (Aox3)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    493909 (Aox3)
   00760 Nicotinate and nicotinamide metabolism
    493909 (Aox3)
   00830 Retinol metabolism
    493909 (Aox3)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    493909 (Aox3)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    493909 (Aox3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     493909 (Aox3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Fer2_2 Ald_Xan_dh_C Fer2
Motif
Other DBs
NCBI-GeneID: 493909
NCBI-ProteinID: NP_001008527
RGD: 1359328
Ensembl: ENSRNOG00000062125
Vega: OTTRNOG00000002208
UniProt: Q5QE80
Position
9q31
AA seq 1334 aa AA seqDB search
MSRSKESDELIFFVNGKKVIERNADPEVNLLFYLRKIIQLTGTKYGCGGGDCGACTVMIS
RYNPISKKISHFSAAACLVPICSLHGAAVTTVEGIGSTKTRIHPVQERIAKGHGTQCGFC
TPGMVMSIYTLLRNHPEPSTEQIMETLGGNLCRCTGYRPIVESARSFSPNSACCPMNEKW
KCCLDEGKNEPERKNSVCTKLYEKEEFQPLDPTQELIFPPELMRMAEDSPNTVLTFRGER
TTWIAPGTLNDLLELKMEYPSAPLVIGNTCLGLDMKFKDVSYPIIISPARILELFVVTNT
NEGLTLGAGLSLTQVKNILSDVVSRLPKERTQTYRALLKHLRTLAGQQIRNVASLGGHII
SRLPTSDLNPIFGVGNCKLNVASTEGTQQIPLNDHFLAGVPEAILKPEQVLISVFVPLSR
KWEFVSAFRQAPRQQNAFAIVNAGMRVAFKEDTNTITDLSILYGGIGATVVSAKSCQQLI
GRCWDEEMLDDAGRMIREEVSLLTAAPGGMVEYRKTLAISFLFKFYLDVLKQLKRRNPHR
CPDISQKLLQVLEDFPLTMPHGTQSFKDVDSQQPLQDQSGRPIMHQSGIKHATGEAVFCD
DMSVLAGELFLAVVTSSKPHARIISLDASEALASPGVVDVITAQDVPGDNGREEESLYAQ
DEVICVGQIVCAVAADSYARAKQATKKVKIVYEDMEPMIVTVQDALQHESFIGPEKKLEQ
GNVQLAFQSADQILEGEVHLGGQEHFYMETQSVRVIPKGEDMEMDIYVSSQDAAFTQEMV
ARTLGIPKNRITCHVKRVGGGFGGKTSKPGLLASVAAVAAQKTGRPIRFILERGDDMLIT
GGRHPLLGKYRVGFMNNGKIKAADIQLYINGGCTPDDSELVIEYALLKLENAYKIPNLRV
RGRVCKTNLPSNTAFRGFGFPQGAFVTGTWVSAVAAKCHLPPEKVRELNMYKTIDRTIHK
QEFDPTNLIKCWETCMENSSYYSRKKAVDEFNQQSFWKKRGIAIIPMKFSVGFPKTFYHQ
AAALVQIYTDGSVLVAHGGVELGQGINTKMIQVASRELKIPMSYIHLDEMNTMTVPNTIT
TGGSTGADVNGRAVQNACQILMKRLEPIISQNPNGDWEEWINEAFIQSISLSATGYFRGY
QADMDWEKGEGDIYPYFVFGAACSEVEIDCLTGAHKNIRTDIVMDGSFSINPAVDIGQIE
GAFVQGLGLYTLEELKYSPEGVLYTRGPHQYKIASVSDIPEEFHVSLLTPTQNPKAIYSS
KGLGEAGMFLGSSVFFAIAAAVAAARKERGLPLILAINSPATAEVIRMACEDQFTNLVPK
TDSKCCKPWSIPVA
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgttctaaggagtcagatgagctcattttctttgtgaatgggaaaaaagtcatt
gagaggaatgcagaccctgaggttaatttattgttctatttgagaaaaatcatccaactc
acagggacaaagtatggctgtggaggaggtgactgtggcgcctgcacagtgatgatctca
agatacaaccccatctccaaaaagatcagtcatttctccgccgctgcctgcctggtcccc
atctgctctctccatggggctgctgtcactacagtagaaggcataggaagcaccaaaacc
agaatacaccctgtccaggaaaggattgctaaaggccatggtacccagtgtggattctgc
actcccgggatggtgatgagcatctacactctcctgagaaaccacccggagccctccacg
gaacagataatggaaaccttgggtgggaatctatgccgttgcactggatacaggcccatt
gtggagagtgcgagaagtttcagccctaactcagcttgctgcccgatgaatgagaaatgg
aaatgttgcttggatgaaggaaaaaacgagcctgagagaaaaaacagtgtttgcaccaag
ttatatgaaaaagaagaatttcaacccttggacccaactcaggagcttatatttccacct
gaactgatgagaatggcagaggattccccaaatacagttctgactttccgtggggaaagg
acgacctggattgccccaggaaccctaaatgaccttctggaactgaaaatggagtacccc
agtgctccgctcgtgatcggcaacacgtgtcttgggcttgatatgaagttcaaagacgtt
tcttatccaattatcatctctcctgcaaggatcttagaattatttgtggtgactaataca
aatgaagggctgacactgggcgctggcctcagcctgacccaggtgaagaatatcttgtct
gatgtggtctccaggctcccgaaggagaggacgcagacataccgtgctctcctgaagcac
ctgaggactctggctgggcagcagatcaggaatgtggcttccttaggtggtcatattatc
agtagactgccgacctctgacctcaaccctattttcggtgtaggcaattgcaaactcaat
gttgcttcaacagaaggaacacagcaaatccctctgaacgatcattttctcgctggagtc
ccagaggccatcctgaagccagagcaagtgctcatctcggttttcgtgcccctctccagg
aagtgggagttcgtatcagctttcagacaggccccgcgtcagcaaaatgcgtttgcgata
gtgaatgctggaatgcgagtcgctttcaaagaggatacaaacaccattacagacttgagc
atcttatatggagggattggtgccactgtagtcagcgccaagtcctgccagcagctgatt
ggaaggtgttgggatgaggaaatgctggatgacgctggccggatgattcgtgaagaagtc
tccctcctcacagcagcccccggaggaatggtggaataccggaagacccttgccatcagt
ttcctcttcaagttttacttagatgtgttgaagcagctaaagaggaggaatccccatagg
tgccctgacatctcacagaaactcctacaggttctggaagactttcctttgaccatgcct
catgggacacagtcatttaaagatgtagactcccagcagcctctgcaagaccagtcgggc
cgtcccatcatgcatcagtctggcatcaaacacgccacaggggaggccgtattttgtgat
gatatgtctgtgttggcaggggaactcttcttagctgtggtaaccagcagcaagccacat
gctagaatcatctccctcgatgcctctgaggccttggcatcacctggtgtggttgatgtg
ataacagctcaagatgtgcctggtgacaatggcagagaagaggaaagcctgtatgcacag
gatgaggtgatctgcgtgggtcagattgtctgcgccgtggctgctgactcgtatgctcgc
gccaagcaggccacaaaaaaagtaaagattgtctatgaagacatggagcccatgattgtg
acggttcaggatgcactgcaacatgaatcattcattggacctgaaaaaaaactagaacaa
ggaaatgtccagttagcatttcaaagtgctgatcaaatcctcgaaggggaagtgcacttg
ggaggccaggagcatttttacatggagactcaaagcgtacgagtgatccccaagggagag
gacatggagatggacatatatgtgtccagccaggacgcagcgtttacccaggaaatggtg
gctcgaaccttgggcatcccaaagaacaggatcacctgccacgtgaaaagggttggtgga
ggcttcggagggaaaacgagcaaacctgggctcctggcatcggtggcagctgtggccgca
cagaagaccggccgcccaatccgttttattctagagcgtggggatgacatgttgataacg
ggaggacgtcacccactactcgggaaatacagggttggcttcatgaacaatgggaagatc
aaggcagcagacatccagctttatatcaacggaggctgcaccccagatgattctgaactg
gtgatagaatatgctttgctcaaactggaaaatgcgtacaagatccccaacctccgtgtc
cgaggtcgcgtctgtaagaccaacttgccatccaatacagcgtttcggggatttggtttt
ccccagggggcattcgtaacaggaacctgggtgtcagctgtggcagccaaatgccacttg
ccaccagagaaggttcgagagttaaacatgtacaaaacaatcgacaggacaattcacaag
caagaatttgacccaacgaatctgataaagtgctgggagacatgtatggaaaattcttcc
tactacagcagaaagaaggctgtagatgaatttaaccagcagagtttttggaagaagaga
ggaattgccatcatccccatgaagttctcagttggatttccaaagacattttatcatcag
gctgctgctttggtccagatctacacagatgggtctgtactagttgctcatggtggtgtt
gaactgggacaaggtattaacaccaaaatgatacaggtggctagccgtgaattaaaaata
ccaatgtcttatatacacctggatgaaatgaacactatgaccgtccccaacacgattacc
actggaggctccactggtgccgatgtcaacgggagagctgttcagaatgcctgtcagatc
ctcatgaagcgcctggaacccatcatcagccagaatcctaatggtgactgggaagagtgg
attaatgaagctttcattcaaagcattagcctctctgccactggatattttaggggttac
caagctgacatggactgggagaagggagaaggtgacatttatccctattttgtttttgga
gctgcctgttctgaggttgaaattgattgtctgacgggagctcacaagaacatcagaact
gacattgtcatggatggatctttcagtataaaccctgctgtggacataggccagatcgaa
ggggcatttgttcaaggtcttggactttatactctagaggaactgaaatattcccctgaa
ggagtcctatacacccgtggtccacaccagtacaaaatagcatcagttagcgacatccca
gaagaattccatgtatcattgttgacaccaacccaaaaccccaaagccatctactcttct
aagggccttggtgaagctggaatgtttctaggttcttctgtgttcttcgctattgctgct
gccgtggctgccgcccgcaaggagagaggcctgcccctgattttggccataaacagccct
gccacagcagaagtaattcgaatggcctgtgaggaccagtttacaaacctggttccaaaa
acggattctaaatgctgtaagccatggtccatcccagttgcctga

DBGET integrated database retrieval system