KEGG   Rattus norvegicus (rat): 497197Help
Entry
497197            CDS       T01003                                 

Gene name
Plcz1
Definition
phospholipase C, zeta 1 (EC:3.1.4.11)
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rno00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:rno04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:rno04070]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:rno04114]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:rno04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q44
AA seq 645 aa AA seqDB search
MESHYELAEARWFMSKIQDYFRGGKISAGITHKLLEKLDFPCHFAHVKRIFKENDRHNQG
RITTEDFRTIYRCIVHREEIVEIFNTYTENRKILPEDSLIEFLTQEQYEMEMDESSSVEI
IQKYEPIAEVKNERQMSIEGFARYMFSSECLLFKETCNTVYQDMNKPLNDYYISSSHNTY
LISDQILGPSDIWGYISALVKGCRCLEIDCWDGAQNEPIVYHGYTLTSKLLFKTVIQAIN
KYAFVTSDYPVVLSLENHCSPGQQEVMTDILQSTFGDFLLSDILDEFPDSLPSPEALKFK
ILVKNKKVGTLSETRERLGTDKRGIALDLEEEIYENEDEDSGKEPETWDDFLSRVKEEQE
ADPSTLSGIADAKKKIRKLRVALALSDLVIYTKAEKFRNFQYSRVYQQFNETTSMGESRA
RKLSKLRAHEFIFHTAAFITRVYPKFTRADSSNFNPQEFWNVGCQMVALNFQTPGLPMDL
QNGKFLDNGGSGYVLKPDFLRDTTLGFNPNEPEGDGHPVTLTIRLISGIQLPVNVPSNTS
DIIVIIEVYGVPNDHMKQQSRAVKNNAFSPRWNETFTFLIQVPELALIRFVVETQGFLSG
NELLGQYTLPVLCMNKGYRRVPLFSKSGANLEPSSLFIYVWYYRE
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggagagccattatgagctcgcagaagcaagatggtttatgtcaaagattcaggattat
tttagaggtggaaaaatcagcgctggaattactcacaaactgctcgagaaacttgatttc
ccatgccattttgctcatgtgaaacgtatttttaaggaaaatgacagacataaccaagga
agaatcaccaccgaagattttagaaccatctatcggtgtattgtacatagagaagagatc
gttgagattttcaacacgtatactgaaaacaggaaaattctccccgaggacagtctgatt
gaatttctaacccaagagcagtatgaaatggagatggatgagtccagttcagtggagatc
atccagaagtacgagcccattgcagaagtaaagaacgagcggcagatgtcaattgaaggt
tttgcaagatacatgttttcttcagaatgtctactgtttaaagagacgtgtaacacagtg
taccaagatatgaataagccactaaatgattactatatttcatcgtctcacaacacatat
ttgatatctgatcaaatattgggaccaagtgacatttggggatatataagtgccctcgtg
aaaggctgccgctgtctggaaattgactgctgggatggagcacaaaatgaacccattgtg
taccatggctacactctcaccagcaagcttctcttcaaaaccgttatccaagcaataaac
aagtacgccttcgtgacgtctgattacccagtggtgctgtccttagagaatcactgctcc
cctggtcaacaggaagtgatgaccgacattctgcagagtacctttggagactttctgctc
tcagacatacttgacgagtttccagacagtttgccatctccagaggcactaaaattcaaa
atattagtgaaaaataagaaagttggaaccttatctgaaacccgcgagaggctggggact
gacaaaaggggcatagcgctagacttggaagaagaaatctatgaaaatgaagacgaagac
tcaggaaaggagccagaaacgtgggatgatttcctgtcacgggttaaggaggagcaggag
gcagacccctcaacgttgagcggaatagcagatgccaagaaaaagatcaggaagctaaga
gtagctctggccttatctgatcttgtcatttataccaaagctgagaagttccgaaacttc
caatattcaagagtctatcagcagtttaatgagaccacttctatgggagagtctcgagct
cgaaaactttcaaaattgagagcccatgagtttattttccacactgcagcgttcatcacc
agagtgtaccccaagttcacgagagcagactcttctaattttaatcctcaagagttttgg
aatgtgggctgtcagatggtggccttgaattttcaaacccctggactgcctatggatttg
caaaacgggaaatttttggataatggaggctctggatatgttttgaagccagactttctt
agagacacaactttgggctttaacccaaatgaaccagaaggagatggccatccggttacc
ctcacgatccgactcatcagtgggatccagttgcctgttaacgtgccctcaaatacatct
gacataatagtgatcatagaagtctacggtgtcccaaacgaccacatgaagcagcagagt
cgtgccgttaagaacaatgcttttagtccaaggtggaatgaaacattcacatttcttatt
caagtgccagaattggcactgatacgtttcgttgttgaaactcaaggcttcctatcggga
aatgaattacttgggcagtacactttacccgttctttgcatgaacaaaggttatcgtcgc
gttcctctgttttccaaatccggtgcgaaccttgaaccttcctctctgtttatttacgtt
tggtactacagagagtga

DBGET integrated database retrieval system