KEGG   Rattus norvegicus (rat): 497197Help
Entry
497197            CDS       T01003                                 

Gene name
Plcz1
Definition
phospholipase C, zeta 1 (EC:3.1.4.11)
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    497197 (Plcz1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    497197 (Plcz1)
   04070 Phosphatidylinositol signaling system
    497197 (Plcz1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    497197 (Plcz1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    497197 (Plcz1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     497197 (Plcz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q44
AA seq 645 aa AA seqDB search
MESHYELAEARWFMSKIQDYFRGGKISAGITHKLLEKLDFPCHFAHVKRIFKENDRHNQG
RITTEDFRTIYRCIVHREEIVEIFNTYTENRKILPEDSLIEFLTQEQYEMEMDESSSVEI
IQKYEPIAEVKNERQMSIEGFARYMFSSECLLFKETCNTVYQDMNKPLNDYYISSSHNTY
LISDQILGPSDIWGYISALVKGCRCLEIDCWDGAQNEPIVYHGYTLTSKLLFKTVIQAIN
KYAFVTSDYPVVLSLENHCSPGQQEVMTDILQSTFGDFLLSDILDEFPDSLPSPEALKFK
ILVKNKKVGTLSETRERLGTDKRGIALDLEEEIYENEDEDSGKEPETWDDFLSRVKEEQE
ADPSTLSGIADAKKKIRKLRVALALSDLVIYTKAEKFRNFQYSRVYQQFNETTSMGESRA
RKLSKLRAHEFIFHTAAFITRVYPKFTRADSSNFNPQEFWNVGCQMVALNFQTPGLPMDL
QNGKFLDNGGSGYVLKPDFLRDTTLGFNPNEPEGDGHPVTLTIRLISGIQLPVNVPSNTS
DIIVIIEVYGVPNDHMKQQSRAVKNNAFSPRWNETFTFLIQVPELALIRFVVETQGFLSG
NELLGQYTLPVLCMNKGYRRVPLFSKSGANLEPSSLFIYVWYYRE
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggagagccattatgagctcgcagaagcaagatggtttatgtcaaagattcaggattat
tttagaggtggaaaaatcagcgctggaattactcacaaactgctcgagaaacttgatttc
ccatgccattttgctcatgtgaaacgtatttttaaggaaaatgacagacataaccaagga
agaatcaccaccgaagattttagaaccatctatcggtgtattgtacatagagaagagatc
gttgagattttcaacacgtatactgaaaacaggaaaattctccccgaggacagtctgatt
gaatttctaacccaagagcagtatgaaatggagatggatgagtccagttcagtggagatc
atccagaagtacgagcccattgcagaagtaaagaacgagcggcagatgtcaattgaaggt
tttgcaagatacatgttttcttcagaatgtctactgtttaaagagacgtgtaacacagtg
taccaagatatgaataagccactaaatgattactatatttcatcgtctcacaacacatat
ttgatatctgatcaaatattgggaccaagtgacatttggggatatataagtgccctcgtg
aaaggctgccgctgtctggaaattgactgctgggatggagcacaaaatgaacccattgtg
taccatggctacactctcaccagcaagcttctcttcaaaaccgttatccaagcaataaac
aagtacgccttcgtgacgtctgattacccagtggtgctgtccttagagaatcactgctcc
cctggtcaacaggaagtgatgaccgacattctgcagagtacctttggagactttctgctc
tcagacatacttgacgagtttccagacagtttgccatctccagaggcactaaaattcaaa
atattagtgaaaaataagaaagttggaaccttatctgaaacccgcgagaggctggggact
gacaaaaggggcatagcgctagacttggaagaagaaatctatgaaaatgaagacgaagac
tcaggaaaggagccagaaacgtgggatgatttcctgtcacgggttaaggaggagcaggag
gcagacccctcaacgttgagcggaatagcagatgccaagaaaaagatcaggaagctaaga
gtagctctggccttatctgatcttgtcatttataccaaagctgagaagttccgaaacttc
caatattcaagagtctatcagcagtttaatgagaccacttctatgggagagtctcgagct
cgaaaactttcaaaattgagagcccatgagtttattttccacactgcagcgttcatcacc
agagtgtaccccaagttcacgagagcagactcttctaattttaatcctcaagagttttgg
aatgtgggctgtcagatggtggccttgaattttcaaacccctggactgcctatggatttg
caaaacgggaaatttttggataatggaggctctggatatgttttgaagccagactttctt
agagacacaactttgggctttaacccaaatgaaccagaaggagatggccatccggttacc
ctcacgatccgactcatcagtgggatccagttgcctgttaacgtgccctcaaatacatct
gacataatagtgatcatagaagtctacggtgtcccaaacgaccacatgaagcagcagagt
cgtgccgttaagaacaatgcttttagtccaaggtggaatgaaacattcacatttcttatt
caagtgccagaattggcactgatacgtttcgttgttgaaactcaaggcttcctatcggga
aatgaattacttgggcagtacactttacccgttctttgcatgaacaaaggttatcgtcgc
gttcctctgttttccaaatccggtgcgaaccttgaaccttcctctctgtttatttacgtt
tggtactacagagagtga

DBGET integrated database retrieval system