KEGG   Rattus norvegicus (rat): 497770Help
Entry
497770            CDS       T01003                                 

Gene name
Scn3a, Nav1.3, SCIII, Scn2a
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 3
  KO
K04836  
voltage-gated sodium channel type III alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    497770 (Scn3a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   497770 (Scn3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21
AA seq 1951 aa AA seqDB search
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDIDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYVSKKTFVVLNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCSQWPPSDSAFETNTTSYFNGTMD
SNGTFVNVTMSTFNWKDYIADDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNHRADGDRFPKSESEDSVKRRSFLLS
LDGNPLTGDKKLCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHST
FEDSESRRDSLFVPHRPGERRNSNGTTTETEVRKRRLSSYQISMEMLEDSSGRQRSMSIA
SILTNTMEELEESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITIC
IVLNTLFMAMEHYPMTQQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDG
IIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVL
AIIVFIFAVVGMQLFGKSYKECVCKINVDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMW
DCMEVAGQTMCLIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVG
RMQKGIDFVKNKIRECFRKAFFRKPKVIEIQEGNKIDSCMSNNTGIEISKELNYLKDGNG
TTSGVGTGSSVEKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEES
KEKLNATSSSEGSTVDVAPPREGEQAEIEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKG
KIWWNLRKTCYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTY
IFILEMLLKWVAYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRAL
RPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNTTT
GNMFEIKEVNNFSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDS
RDVKLQPIYEENLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQ
KKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDD
QSKYMTLVLSRINLVFIVLFTGEFLLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAEL
IEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIY
AIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPD
AIHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDD
FEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHC
LDILFAFTKRVLGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQR
NYRCYLLKQRLKNISSKYDKETIKGRIDLPIKGDMVIDKLNGNSTPEKTDGSSSTTSPPS
YDSVTKPDKEKFEKDKPEKEIKGKEVRENQK
NT seq 5856 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggcactgctggtacccccgggacctgagagcttccgccttttcactcgagaa
tctcttgctgctatcgaaaagcgtgctgcagaagagaaagccaagaaacccaagaaagag
caagacattgacgatgagaacaaaccaaagccaaacagcgacttggaagctgggaagaac
cttccatttatctatggagacattcctccagagatggtgtcagagcccctggaggacctg
gacccctactatgtcagtaagaaaacttttgtagtgttgaataaagggaaggcgattttt
cgattcagcgccacctccgccctgtatattttaactccgctaaaccctgttaggaaaatt
gccattaagattttggtacactctttgttcagcatgcttatcatgtgcactattttgacc
aactgtgtatttatgacgttgagtaatcctcccgactggacaaagaatgtagagtatacg
ttcactgggatctatacctttgagtcacttataaagatcttggcaagagggttttgctta
gaagatttcactttcctccgtgacccatggaactggctggatttcagtgtcatcgtgatg
gcatatgtgacagagtttgtggacctgggcaatgtctcagcgctgagaacgttcagagtt
ctccgagcattgaaaacaatatcagtcattccaggtttaaagaccatcgtgggggccctg
atccagtccgtgaagaagctgtccgacgtcatgatcctcaccgtgttctgtctcagtgtc
tttgctctaatcgggctgcagctcttcatgggcaacctgaggaataaatgctcgcagtgg
cccccgagcgattcggcttttgaaaccaacactacttcctacttcaatggcacaatggat
tcaaatgggacatttgttaatgtaacaatgagcactttcaactggaaggattatatcgca
gatgacagtcacttttatgtcttggatggacaaaaagatcctttactctgtggaaatggc
tccgatgcaggacaatgtccagaagggtacatctgtgtgaaggctggacgaaaccccaac
tacggctacacaagctttgacaccttcagctgggccttcttgtccctgtttcgactcatg
actcaggactactgggagaatctttaccagttgacattgcgtgcagctgggaaaacctac
atgatatttttcgtcctggtaattttcttgggctcgttttatttggtgaacttgatcctg
gctgtggtggccatggcctatgaggagcagaaccaggccacactggaggaggctgaacag
aaggaggcagagtttcagcagatgctggagcaactgaagaagcagcaggaggaggctcag
gcagtggctgcagcctccgcggcatccagagacttcagtggaataggagggttaggagaa
cttctggagagttcttcagaagcttccaagttgagctccaagagtgctaaggagtggagg
aaccggaggaagaagaggagacagagggaacacttggagggaaaccacagagccgatgga
gacaggtttcccaagtcggaatcggaagacagtgtcaaacgaagaagcttcctgctctcc
ctggatggcaacccgctgactggtgacaagaagctgtgctctccccaccagtctctcttg
agtatccgtggctccctgttttccccaagacgcaatagcaaaacgagcattttcagcttc
agaggtcgggcgaaggacgtggggtctgagaatgactttgcagacgatgagcacagcacc
ttcgaggacagcgagagcaggagagactccctgtttgtgccgcacagacctggagagcga
cgcaacagtaacggtaccaccactgaaacggaagtcaggaagagaaggctaagttcttac
cagatttcaatggaaatgctggaggattcctctggaagacaaagatccatgagcatagcc
agtatcctgaccaacaccatggaggaacttgaagaatctagacagaagtgcccaccatgc
tggtatagattcgccaatgtgtttttgatctgggactgctgtgatgcatggttaaaagtg
aagcatcttgtgaatttaattgtgatggatccatttgttgatcttgccataacaatttgc
atcgtattaaatacactgttcatggccatggagcactatcccatgacccagcagttcagc
agtgtgctgactgtgggaaacctggtcttcactgggatcttcacagccgaaatggtcctt
aaaatcattgccatggacccctattattatttccaagagggctggaatattttcgatgga
attattgttagcctgagtttaatggagctaggcctggcaaatgtggaggggctgtctgtg
cttcggtccttcagactgctccgagtcttcaagttggcaaagtcctggcccacactgaac
atgctcattaagatcatcggcaactcggtgggcgcactgggcaacctgaccctggtgctg
gccatcatcgtcttcatttttgccgtggtcggcatgcagctgtttggaaagagctacaag
gagtgtgtctgcaagatcaatgtggactgcaagctgccgcgctggcacatgaacgacttc
ttccactccttcctgatcgtgttccgagtgctgtgtggggagtggatagagaccatgtgg
gactgcatggaggtcgcgggccagaccatgtgccttattgtgttcatgttggtcatggtg
attgggaaccttgtggttctgaacctctttctggccttattgttgagttcctttagttca
gataaccttgctgctactgacgatgataacgaaatgaacaacctccagatcgcggtggga
aggatgcaaaagggaattgattttgtgaaaaataagatacgggagtgcttccgaaaagcg
tttttcagaaagccgaaagtgatagaaatccaagaaggcaacaaaatagacagctgcatg
tccaataacacgggcatcgaaataagcaaagagcttaactaccttaaagacggtaatgga
accaccagcggcgtgggaaccggaagcagtgtggaaaaatacgtaatcgatgaaaatgac
tacatgtcattcataaacaatcccagcctcaccgtgactgtgccaattgctgtgggagag
tctgactttgaaaatttaaatacggaagagttcagcagtgagtcagaattggaagaaagt
aaggagaaattaaatgcaaccagctcttctgaaggaagcacagttgatgttgctccaccc
cgagaaggtgaacaagcagaaattgaacctgaggaggaccttaagccagaagcttgtttt
actgaagggtgcattaaaaaattccccttctgtcaagtaagtacagaagaaggtaaagga
aaaatatggtggaatcttaggaagacatgctacagcattgtggagcacaactggtttgag
acattcattgtgttcatgattctcctcagtagtggcgctttggcctttgaggatatatac
attgagcaacgaaagacgatcaagaccatgctggagtatgcagacaaggtcttcacgtac
atcttcatcctggagatgctcctcaaatgggtggcctatggatttcaaacctatttcacc
aatgcctggtgctggttggacttcctgatcgttgatgtttctttggttagcctggtagcc
aatgctcttggttactcagaacttggtgccatcaaatccctacggacactgagagctctg
aggccgctccgagccttatcccgctttgaaggcatgagggtggttgtaaatgctcttgtt
ggtgcaattccctccatcatgaatgtgttattggtgtgtctcatcttctggctgattttt
agcatcatgggtgtgaatctgtttgctggaaagttctatcactgtgttaacacgacaaca
ggcaacatgtttgaaataaaagaagtgaacaatttcagtgactgtcaggctcttggcaag
caagcccggtggaagaatgtgaaagtcaactttgacaacgttggggctggctacctggca
ttgctgcaagtggccacattcaaaggctggatggacatcatgtatgcagctgttgattcg
cgggacgtcaaactgcagcccatatatgaagaaaacctgtacatgtacctgtactttgtc
atcttcatcatcttcggctcgttcttcactctaaatctattcatcggtgtcatcatagac
aacttcaaccagcagaagaagaagtttggaggtcaagacatctttatgacagaagaacag
aagaaatactacaatgcaatgaagaagctcggctcaaagaaacctcagaagcccatccct
cggcctgcaaacaaatttcaagggatggtctttgattttgtaaccagacaagtgtttgac
atcagcatcatgatcctcatctgcctcaacatggtgaccatgatggtggaaacggatgac
cagagcaaatacatgaccctggttttgtcccgaatcaacctagtgttcattgtcctcttc
actggggagtttctgctgaagctcatctccctcagatactactacttcacgatagggtgg
aacatctttgactttgtggtggtgattctctcgattgtaggaatgtttctcgcagagctg
atagagaagtatttcgtgtcccctaccctgttccgagtcatccgcctggccaggattgga
cgaatcctacgcctgatcaaaggcgccaaggggatccgcactctgctctttgctttgatg
atgtcccttcctgcgctgttcaacatcggcctcctgcttttcctggtcatgttcatctac
gccatctttgggatgtccaactttgcctatgttaaaaaagaggctggaattgatgacatg
ttcaactttgagacttttggcaacagcatgatctgcttgttccaaatcaccacctctgcc
ggctgggacggactgctggcccccatcctcaacagcgcacctcccgactgtgaccccgat
gcaattcaccctggaagctcggtgaagggggactgtgggaacccatccgtggggattttc
ttttttgtcagctacatcatcatatccttcctggtggtggtgaacatgtacatcgctgtc
atcctggagaacttcagcgtcgccaccgaagaaagtgcagagcccctgagtgaggacgac
tttgagatgttctacgaggtctgggagaagttcgaccctgacgccactcagttcatagag
ttctgcaagctttctgactttgcagctgccctggatcctcccctcctcatcgcaaagcca
aacaaagtccagctcattgccatggacctgcccatggtgagtggagaccgcatccactgc
ctggacatcttgtttgcttttacaaagcgggtcctgggcgagagtggagagatggacgct
cttcgaatccagatggaagatcgcttcatggcttccaacccctccaaggtctcttatgag
cccattaccaccaccctgaaacggaaacaagaggaggtgtctgctgctatcattcagcgt
aattatagatgttatcttttaaagcaacggttaaaaaacatatcgagtaaatacgacaaa
gagacaatcaagggaaggattgacttgcctataaaaggagatatggttattgacaaattg
aatgggaattccaccccagaaaagacggatgggagttcctccacaacctctcctccttcc
tatgacagtgtaacaaaaccagataaggaaaagtttgagaaagacaaaccagaaaaagaa
atcaaagggaaagaggtcagagagaatcaaaagtaa

DBGET integrated database retrieval system