KEGG   Rattus norvegicus (rat): 497961Help
Entry
497961            CDS       T01003                                 

Gene name
Nlk, RGD1561602
Definition
nemo like kinase (EC:2.7.11.24)
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    497961 (Nlk)
   04310 Wnt signaling pathway
    497961 (Nlk)
   04068 FoxO signaling pathway
    497961 (Nlk)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    497961 (Nlk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     497961 (Nlk)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   497961 (Nlk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q25
AA seq 527 aa AA seqDB search
MSLCGTRANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacacgagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacaccttcctcct
cctcaccttcaccaccaccaccaccctcaacaccaccttcatccggggtcggctgctgct
gtacaccctgtacagcagcatacgtcttcggcagctgcggcagccgcagcggcagctgcg
gccgcagccatgttaaaccctgggcaacaacagccatatttcccatcaccggcacctggt
caggctcctgggccagctgcagcagccccagctcaggtacaggctgctgcagctgctaca
gttaaggcgcaccatcatcagcactcgcatcatccgcaacagcagctggacattgagccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcactcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agagtcttccgggaattgaagatgttgtgtttttttaaacatgataatgtactctctgcc
cttgacatactccagcctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgatctacataaaattatcgtctctcctcagccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttacatcgcgacattaagccggggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaagaattggatgaatcccgtcacatgactcaggaa
gttgttactcagtattaccgggctccggagatcctcatgggcagccgccattacagcaat
gctattgacatctggtctgtggggtgcatctttgcagagctgctgggccgaaggatactg
tttcaggcgcagagtcccattcagcagttggatttgatcacagatctgttgggcacgcca
tcactggaagcgatgaggacagcttgtgaaggtgctaaggcacacatactcaggggtcct
cacaaacagccatctctccctgtactctacaccctttccagccaggccacacatgaagcc
gttcacctgctttgcagaatgttggtctttgatccatcaaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcggctgagataccatacatgtatgtgtaag
tgctgcttttccacctcgacgggaagagtctacaccagtgactttgagcctgtcaccaac
cccaaatttgatgacacctttgagaagaacctcagctctgtccgacaagttaaagaaatt
atccaccagttcattttggaacagcagaaaggaaacagagtacctctctgcattaacccg
cagtctgctgcctttaagagctttatcagttccaccgtcgctcagccgtctgagatgcca
ccgtctcctctggtgtgggagtga

DBGET integrated database retrieval system