KEGG   Rattus norvegicus (rat): 497961Help
Entry
497961            CDS       T01003                                 

Gene name
Nlk, RGD1561602
Definition
(RefSeq) nemo like kinase
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    497961 (Nlk)
   04310 Wnt signaling pathway
    497961 (Nlk)
   04068 FoxO signaling pathway
    497961 (Nlk)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    497961 (Nlk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     497961 (Nlk)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   497961 (Nlk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
10q25
AA seq 527 aa AA seqDB search
MSLCGTRANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacacgagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacaccttcctcct
cctcaccttcaccaccaccaccaccctcaacaccaccttcatccggggtcggctgctgct
gtacaccctgtacagcagcatacgtcttcggcagctgcggcagccgcagcggcagctgcg
gccgcagccatgttaaaccctgggcaacaacagccatatttcccatcaccggcacctggt
caggctcctgggccagctgcagcagccccagctcaggtacaggctgctgcagctgctaca
gttaaggcgcaccatcatcagcactcgcatcatccgcaacagcagctggacattgagccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcactcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agagtcttccgggaattgaagatgttgtgtttttttaaacatgataatgtactctctgcc
cttgacatactccagcctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgatctacataaaattatcgtctctcctcagccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttacatcgcgacattaagccggggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaagaattggatgaatcccgtcacatgactcaggaa
gttgttactcagtattaccgggctccggagatcctcatgggcagccgccattacagcaat
gctattgacatctggtctgtggggtgcatctttgcagagctgctgggccgaaggatactg
tttcaggcgcagagtcccattcagcagttggatttgatcacagatctgttgggcacgcca
tcactggaagcgatgaggacagcttgtgaaggtgctaaggcacacatactcaggggtcct
cacaaacagccatctctccctgtactctacaccctttccagccaggccacacatgaagcc
gttcacctgctttgcagaatgttggtctttgatccatcaaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcggctgagataccatacatgtatgtgtaag
tgctgcttttccacctcgacgggaagagtctacaccagtgactttgagcctgtcaccaac
cccaaatttgatgacacctttgagaagaacctcagctctgtccgacaagttaaagaaatt
atccaccagttcattttggaacagcagaaaggaaacagagtacctctctgcattaacccg
cagtctgctgcctttaagagctttatcagttccaccgtcgctcagccgtctgagatgcca
ccgtctcctctggtgtgggagtga

DBGET integrated database retrieval system