KEGG   Rattus norvegicus (rat): 498276Help
Entry
498276            CDS       T01003                                 

Definition
(RefSeq) Fc gamma receptor II beta
  KO
K06472  low affinity immunoglobulin gamma Fc receptor II-a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04611  Platelet activation
rno04666  Fc gamma R-mediated phagocytosis
rno05140  Leishmaniasis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    498276
 Organismal Systems
  Immune system
   04611 Platelet activation
    498276
   04666 Fc gamma R-mediated phagocytosis
    498276
  Development
   04380 Osteoclast differentiation
    498276
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    498276
  Infectious diseases
   05150 Staphylococcus aureus infection
    498276
   05152 Tuberculosis
    498276
   05140 Leishmaniasis
    498276
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    498276
CD molecules [BR:rno04090]
 Proteins
  498276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig I-set Ig_4 Ig_5
Motif
Other DBs
NCBI-GeneID: 498276
NCBI-ProteinID: NP_001129464
RGD: 1594388
UniProt: P27645 B0K007
Position
13q24
AA seq 267 aa AA seqDB search
MTLETQMFQNAHSGSQWLLPPLTMLLLFAFADRQTGDLLKAVVKRDPPWIQVLKDDTVTL
TCEGTHNPGNSSTQWFHNQSSTWGQVQASYTFKATVNDSGEYRCRMAHTSLSDPIHLEVI
SDWLLLQTPQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYYQSSNFSIPKANHS
HSGNYYCKAYLGRTMHVSKPVTITVQGSATASTSSLVWFHAAFCLVMCLLFAVDTGLYFC
VRRNLQTSGEDWRKSLSVGKYKAPQDK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactttggagacccagatgtttcagaatgcacattctggaagccaatggctactccca
ccactgacaatgttgctgctgtttgcttttgcagacaggcagacgggagatcttctgaag
gctgtggtgaaacgtgatcccccatggatccaggtgctcaaggacgacactgtgacgctg
acgtgcgaagggacccacaatcctggaaactcttctacccagtggttccacaaccagagc
tccacctggggccaggtccaagccagctacacgtttaaggccacagtcaatgacagtgga
gaataccggtgccgaatggcgcacaccagcctcagcgaccccatacatctggaagtgatt
tctgactggctgctgctccagacccctcaactggtgtttgaggaaggggaaaccatcaca
ttaaggtgccatagctggaagaacaaacagctgactaaggtcttgttgttccagaatgga
aaacctgtgaggtattattatcaaagcagcaatttttcaatccccaaagccaaccacagt
cacagtgggaactactactgcaaagcatatctaggaaggacaatgcatgtgtccaagcct
gtcaccatcactgtccaaggttcagcaaccgcgtccaccagctctctagtgtggttccat
gccgctttctgcctagtgatgtgcctcctgtttgcagtggacaccggcctgtatttctgt
gtacggagaaatcttcaaacctcgggggaggactggaggaaatccctgtcagtcggaaag
tacaaggctccacaggacaaatga

DBGET integrated database retrieval system