KEGG   Rattus norvegicus (rat): 498731Help
Entry
498731            CDS       T01003                                 

Gene name
RGD1563601
Definition
similar to Tpi1 protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    498731 (RGD1563601)
   01230 Biosynthesis of amino acids
    498731 (RGD1563601)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    498731 (RGD1563601)
   00051 Fructose and mannose metabolism
    498731 (RGD1563601)
   00562 Inositol phosphate metabolism
    498731 (RGD1563601)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     498731 (RGD1563601)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   498731 (RGD1563601)
  Exosomal proteins of bladder cancer cells
   498731 (RGD1563601)
  Exosomal proteins of melanoma cells
   498731 (RGD1563601)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
17p12
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKMPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHIFGESDELIGQKVNHALSE
GLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKCNVSEEVAQCTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FLDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttccaggaagttcttcgtcgggggcaactggaagatgaacgggaggaagaaa
tgcctgggagaactcatctgcaccctgaacgcagccaagatgccggcagacaccgaggtg
gtttgtgcaccgccaaccgcctacatcgacttcgccaggcagaagctggatcccaaaatt
gctgtggctgcacagaactgctacaaagtgaccaatggggccttcactggggaaatcagc
cctggcatgatcaaagacttaggagctacctgggtggtgctgggacactcggaaagaaga
cacatctttggggaatcagacgagttgattgggcagaaagtgaaccatgccctatccgag
ggactcggagtgatcgcctgcattggggagaagttagacgaaagggaagctggcatcact
gagaaggttgtttttgagcaaaccaaggccatcgcagataatgtgaaggactggtccaag
gtggtcctggcctatgaaccggtatgggccattgggactggcaagactgcaacccctcaa
caggcccaggaagtacacgagaagctccggggatggctgaagtgcaacgtctctgaggag
gtggctcagtgcactcggatcatttatggaggttctgtgactggagcgacttgcaaagag
ctggcaagccagcctgatgtggatggcttcctcgtgggcggtgcatctctcaagcctgaa
ttcctggacattatcaatgccaaacaatga

DBGET integrated database retrieval system