KEGG   Rattus norvegicus (rat): 498940Help
Entry
498940            CDS       T01003                                 

Gene name
Ces2h, Ces2
Definition
carboxylesterase 2H (EC:3.1.1.1)
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
rno  Rattus norvegicus (rat)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    498940 (Ces2h)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     498940 (Ces2h)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     498940 (Ces2h)
    3.1.1.84  cocaine esterase
     498940 (Ces2h)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19q11
AA seq 558 aa AA seqDB search
MGLKQIHARLTTAACGLLLLLQVQGQDSLSPIRTTHTGQILGSLIHMKGLDVGVHSFLGI
PFAKPPIGPLRFAPPEAPEPWSGVRDGTSHPAMCLQDITAMNMQAFKLLKLTLPLIPMSE
DCLYLNIYTPNHAHEGSNLPVMVWIHGGALVIGMASLYDGSMLAAMENVVVVTIQYRLGV
LGFFSTGDQHARGNWGYLDQVAALHWVQQNIAHFGGNPDRVTIFGESAGGTSVSSHVVSP
MSRGLFHGAIMESGVALMSSLISVSSDVVYRTVANLSGCEQVDSKALVNCLRGKSEEEIM
SINKAFRIISGIVDGIFLPRHPKELLASADFHPIPSIIGVNNDEYGWIIPSSMTTTDSKK
KMDRQMVQAILQKRVAQMMWPPEFSDLLLEEYMGDSEDPQFLQVQFKEMMEDFTFVIPAL
QVAHFQRSNAPVYFYEFQHRPSFFKDSKPPHVKADHGDEILFIFRSFWGGTQVDLTEEEE
LLSRRMMKYWANFARQGNPNSEGLPYWPVFDHDEQYLQLDTQPAVGRALKAKRLQFWTKT
LPEKIRELKDTEDRHTEL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgggactgaaacaaattcacgctcggctaaccaccgcggcctgtgggctcctgcttctc
ctccaggtccagggccaggactcactcagtcccatcaggaccacacacacaggccagata
ctgggcagcctcatccatatgaagggccttgatgtgggtgtccacagcttcctgggaatt
ccctttgccaagcctcctatagggccactgcgctttgctccccctgaggcccctgagcca
tggagtggtgtgagagatgggacctcacatccggccatgtgtctgcaggacatcactgca
atgaatatgcaggcttttaaactgttgaagctgaccttgcctctcatccctatgtctgaa
gactgcctataccttaacatttatacaccaaatcatgcccacgagggttccaacctacct
gtgatggtgtggatccatggaggtgcactggttataggcatggcttcattgtatgatggc
tccatgctggcagccatggagaatgtagtggtggtcactatccaataccgcctaggtgtt
ctgggtttcttcagcacaggagaccagcacgccagggggaactggggatacctggaccaa
gtggccgccctacactgggtccagcagaacatcgcccactttggaggcaaccctgaccgg
gtcaccatttttggcgagtcagcaggtggcacaagtgtgtcttcacacgttgtgtccccc
atgtcccgtgggctcttccatggtgccatcatggagagtggggtggccctgatgtcgagc
ctcatctcagtatcttctgacgttgtctatagaacagtggccaacctttctggatgtgag
caggtggactccaaggctctggtgaactgtctacgaggcaagagcgaggaagagattatg
tctattaacaaggccttcaggatcatctctggcatagtggatggtatcttccttcccaga
catcccaaggagctgttggcctctgctgactttcaccccattcccagcattattggtgtc
aacaatgatgagtatggctggatcattccctcgagcatgaccaccactgactccaagaag
aaaatggacagacagatggtgcaagctatcctgcagaagagggtagcccagatgatgtgg
cctcctgaatttagtgacctgctgctagaggagtacatgggggacagtgaggaccctcag
tttctccaagtgcagttcaaggagatgatggaagacttcacttttgtgatccctgcactg
caagtagcacattttcaacgttccaatgcccctgtctacttctatgagttccaacatcgg
cccagtttcttcaaggactccaagccaccccatgtgaaggctgaccatggtgatgagatt
ctctttatcttcagatcattttggggaggcacccaagttgacctcactgaggaggaggag
ctgctgagcaggaggatgatgaagtactgggccaactttgcacgacaggggaatcccaac
agtgagggtctaccctactggcctgtgtttgaccatgatgagcagtacctgcagctggac
acccagcctgctgtgggacgagccctgaaggccaaaaggctgcagttctggaccaagact
cttcctgaaaagatacgggagttaaaagatactgaggacagacatacagagttgtag

DBGET integrated database retrieval system