KEGG   Rattus norvegicus (rat): 499010Help
Entry
499010            CDS       T01003                                 

Gene name
Syne1, CPG2, Myne-1
Definition
(RefSeq) spectrin repeat containing nuclear envelope protein 1
  KO
K19326  
nesprin-1
Organism
rno  Rattus norvegicus (rat)
Brite
Chromosome [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   LINC complex
    499010 (Syne1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Position
1p11
AA seq 3016 aa AA seqDB search
MFPQELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVEGLAEGTEDVDPELLPT
PSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSPSPVANTEASVNQDIAY
YQALSAEGLQTDAARIAPSAAASQELYEPGLEPSATAKLGDLQRSWETLKNVISEKQRTL
YEALERQQKYQDSLQSVSTKMEAMEMKLSESLQPGRSPESQMAEHQALMDEVQMLQDEIN
GLQASLAEELVAESQESDPAEQLALQSTLTVLAERMSTIRMKAAGKRQLLEEKLNDQLEE
QRQEQALQRYRCEAEELDHWLLNTKATLDFAAGIPQEPMDMDAQLVDCQNMLVEIEQKVV
ALSQLSVRSENLLLEGKAHTKDEAEQLASKLRMLKGSLMELQRALRDRQLNMQGVTQEKE
ENDVDFTATQSPGVQEWLAQARNTRTHQRQSSLQQQKEFEQELAEQKSLLRSVASRGEEI
LIQHSTAEGSGGLGEKPDALSQELVMEGAKSFAEDQMRAKWESLHQEFSTKQKLLQNILE
QEQEQMLYSSPNRLLSGVLPLRGEAQTQDKSSVTSLLDGLSQAFGEVSSQSGGTDRQNIH
LEQKLYDGVSATSTWLDDVEEHLFVATALLPEETETCLFNQEALAKDIKEMSEEMDKNKN
LFSQAFPEDSDNRDVIEDTLGCLLGRLSLLDSVVGQRCHQMKERLQQVLSFQNDLKVLFT
SLADNNYIILQKLANMFKQPIVEQIQAIQQAEEGLRELDGGISELKQRGDKLQVDQSALQ
ELSKLQDMYDELLVTISSRRSNLNQNLALKSQYDKALQDLVDLLDTGQEKMAGDQKIIVS
SKEEVQQLLSKHKEYFQGLESHLILTETLFRKIVDFAAMKETQLHSDRMAQASAVLKQAH
KRGVELEYILEMWSHLDENLQELSRQLEVIENSIPSVGLVEESEDRLVERTSLYQHLKSS
LNEYQPKLYQVLDDGKRLMMSISCSELESQLNQLGERWLGNTNKVSKELHRLETILKHWT
RYQSEAADLIHWLESAKDKLAFWTQQSVTVPQELEMVRDHLNAFLEFSKEVDAKSSLKSS
VTSTGNQLLRLKKVDTAALRAELSCMDSQWTDLLAGIPAVQEKLHQLQMDKLPSRHAISE
VMSWISLMESVILKDEEDIRNAIGYKAIYEYLQKYKGFKIDLNCKQLTADFVNQSVLQIS
SQDVESKRSDKTDFAEQLGAMNKSWQLLQGRVGEKIQMLEGLLESWSEYENSIQSLKAWF
ANQERKLEEHHQIGDQNSVQNALKDCQELEDLIKAKEKEVEKIEQNGLALIQNKREEVSC
SVLNTLWELRQTWASLERTVGQLKIQLTLVLGQWSIHKAAFEEISNHLMEARYSLSRFRL
LTGSSDAVQVQVDNLQNLHDDLEKQEGDLQKFGSLTNHLLKECHPPVAEALSSTLQEVNM
RWNNLLEEIAKQLHSSKALLQLWQRYKDYSKQCASAVQRQEEQTNALLKAATSKDIADDE
VAKWIQDCNDLLKGLGTVKDSLFILHELGEQLGQQVDDSAATTIQCEQLCFSQRLEALEQ
ALCKQQAVLQAGVVDYETFAKSLEALEAWIVEAEGILQAQDPTHSSDLSTIQERMEELKG
QMLKFSSMAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTTERFSKLQSFLLQH
QTFLEKCETWMEFLVQTEHKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIVDG
QNLLEQGQVDDREEFSLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKW
LVEVSHLPLSGLGSIPVPLQQVRTLFDEVQFKEKVFLRQQGSYILTVEAGKQLLLSADSG
AEAALQAELTDIQEKWKSASTHLEEQKKKLAFLLKDWEKCEKGIADSLEKLRTFKKRLSQ
PLPDHHEELHAEQMRCKELENAVGRWTDDLAELVLLREALAAHLSAEDISILKERVELLQ
RQWEELCHQVSLRRQQVSERLNEWAVFSEKNKELCEWLTQMESKVSQNGDILIEEMIEKL
KKDYQEEIAVAQENKIQLQQMGERLAKASHESKASEIQYKLSKVNDRWQHLLDLMAARVK
KLKETLVAVQQLDKNMGSLRIWLAHMESELAKPIVYDSCNSEEIQKKLSEQQELQRDIEK
HSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETW
RLWQKFLDDYSRFEDWLEISERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLEL
INKQYRRLARENRTDSACSLRQMAHGGNQRWDDLQKRVTSILRRLKHFISQREEFETARD
SILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNHSKIEQIIAQGEQLIEKSE
PLDAAVIEEELDELRRYCQEVFGRVERYHKKLIRLPLPDDHDLSDRELDLEDSMALSDLH
WQDPSEDGMPSPQPSSNPSLSLPQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAS
RTLPSEDEEGEEDKEFYLRGAVGLSGDPTSLESQMRQLDKALDDSRFQIQQTANILRGKT
PTGPDLGTSYKGYMKLLGECSGSIDSVRRLEHKLAEEESFPGFTNPTSTETQPAGVIDRW
ELLQAQAMSKELKMKQNLQKWQQFNSDLNNICAWLGETEEELDRLQHLALSTDIHTIKSH
IKKLKELQKALDHRKAIILSINLCSSEFTQADSKESHDLQDRLSQMNRRWDRVCSLLEDW
RGSLQDALMQCQDFHEMTHALLLLLENTDRRKNEIVPIDSTLDPETLQDHHTQLTQIKQE
LLKSQLRVASLQNMSRQLLVNAEGSDCLEAKEKVHVIGNRLKLLLKEVSRHIKDLEKLLG
MSSSQQDLSSWSSADEVDTSGSVSPTSGRSTPNRQKSPRGKCSLSQPGPSVSSPKSRSTK
GGSDSSLSETRPARAGRDFLFRVLRAALPIQLLLLLLIGLTSRVPISEEDYSCALSNNFA
RSFHPMLRYTNGPPPL
NT seq 9051 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctcaggagctggcgcagaaaatcaagggctaccaggagcaaattgcctctttg
aattccaaatgcaagatgctgacgatgaaagccaagcacgctactatgctgctgaccgtg
accgaggtcgagggactggcggaagggaccgaagatgtggaccccgagctcctccccacg
ccttctgcccacccctccgtggtcatgatgactgcaggtcgctgtcacactctgttgtct
cctgtcactgaggagtctggggaggagggaaccaacagtgagatttcctctccacctgcc
tgtcgctccccatcacctgtggctaacactgaggcatccgttaaccaggacattgcgtac
taccaagctctgtctgccgaggggctgcagacagatgctgcgagaatcgcccccagtgcc
gcggcatcccaggagttgtatgagcctgggctggagccttcagcgactgccaaactgggc
gacctacagcgctcctgggaaaccttaaaaaacgtgatcagtgaaaaacagcggactctc
tacgaagctttggaacgccagcagaagtaccaggactccctccagtccgtctcgaccaag
atggaggccatggagatgaagttgagcgagagcctccagccgggccggagtccagaaagc
cagatggctgagcaccaggccctgatggacgaggtgcagatgctgcaagacgagatcaat
gggctccaggcgtctcttgcagaggagctggtggccgagtctcaggagtcggacccagcg
gagcagctagccctgcagtccacgctcactgtcctggctgagcgaatgtccaccatcagg
atgaaagcggctggcaagcggcagcttctggaggagaagctaaatgatcagctggaggag
cagagacaggagcaggctctgcagaggtaccgctgcgaggcagaggagctggaccattgg
ctgttgaacacaaaggctaccctggactttgcagcgggtataccccaggagcctatggac
atggatgcccagctggtggactgccagaacatgctcgtggaaatagaacagaaagtggtg
gccctgtcgcagctgtcggtgcgcagtgagaacctgctgctggagggcaaggctcacacg
aaagatgaggcagagcagctagcctccaagctgaggatgctcaaagggagcctcatggag
ctgcagagggccctgcgtgacagacagctcaacatgcagggagtcacacaagaaaaagaa
gagaatgatgttgacttcacggcgactcagagtcccggagtacaggaatggctggctcaa
gcccgcaacactcggacccaccagcggcagagcagcctccagcagcaaaaggagttcgaa
caggagctggctgagcagaagagcctcctccgctcagtagctagccgtggagaggagatt
ctaatccagcattccaccgcagaaggctcaggtggccttggtgaaaaacctgatgcgtta
tcccaggagttggtgatggaaggggcaaaatcatttgctgaagatcagatgagagcgaag
tgggaaagtctacaccaagagtttagtaccaagcagaagcttctacagaatattctggaa
caggaacaagaacaaatgctttatagcagtccgaacagactcctgtcaggagtgctgcca
ttgagaggggaagcgcagactcaagataagtcttcagtgacgtccttgctggatggactg
agccaggcctttggagaggtgtcatcacagagtggaggaacagacagacagaacattcac
ttggagcagaagttatatgacggagtctcagccacttcaacctggttggatgacgttgaa
gagcatttatttgtggccacagcacttttgccggaagaaacagaaacttgtctcttcaac
caagaggctcttgccaaggacattaaggaaatgtctgaagaaatggataagaacaagaat
ttgttttcccaagcattcccagaggacagtgacaaccgggatgttatcgaagacactctg
ggttgtcttttgggcagattatccctgctggattcagtagtgggtcagcgatgtcatcag
atgaaggaaagactccagcaagtcctcagtttccagaatgacctgaaggtgttgtttaca
tcattagctgacaacaattatatcattctgcagaagctggcaaacatgttcaaacagccc
attgtggaacagatacaggccatacaacaggcggaagagggactgagggagctcgatggt
ggaatctctgagttgaaacagcggggtgacaagttgcaagtggatcaatccgctctgcaa
gaactctccaagctccaggacatgtatgatgagctactggtgaccatcagctcccggagg
agcaacctcaaccagaaccttgcactcaagagtcagtatgacaaggctctgcaagatctg
gtagacctgctggacactgggcaggagaagatggcaggggaccagaagatcattgtatcc
tccaaagaagaagtccagcaactgctcagcaagcacaaggaatacttccagggcctggaa
tcgcatttgattttgactgaaacactcttcagaaagattgttgactttgcagctatgaag
gaaactcagctgcactcggaccgtatggctcaagcttctgctgtgttgaagcaggctcac
aagagaggggtggagcttgagtacatcttagagatgtggtcccatctggatgagaatctc
caggagctcagcagacagctggaggtgatagaaaacagcatcccaagtgtgggcctggta
gaggagagcgaggacagacttgtggaaaggacaagtctctaccagcatttaaaatccagc
cttaacgaataccagcccaaactgtatcaagtgctagatgatgggaagcggcttatgatg
tctatcagctgttcagagcttgaaagtcagctaaatcagctgggagagcgctggctcggt
aatacaaacaaagtatccaaggaactgcacagactggagaccatactgaaacactggacc
aggtatcaaagtgaagctgccgatctgattcactggctagagtctgcaaaggacaagctg
gcattttggactcagcagtctgtgacggtcccacaagaactggaaatggtccgggatcat
ctcaatgctttcctggagttctctaaagaagtagatgccaaatcttccctcaagtcttcg
gtcacaagcacaggaaatcagcttcttcgattaaagaaagtggacacagctgccctgcgt
gctgagctgtcctgcatggacagccagtggactgacctactggcaggcattcctgccgtg
caggagaagctccatcagctccagatggacaagctgccttcccgccatgccatttctgag
gtcatgagttggatctccctcatggaaagtgtcatcctgaaggatgaagaggacataaga
aatgccatcggttacaaggcaatctatgaatacctgcagaaatacaagggtttcaagata
gatcttaactgcaagcagctgacggcggactttgtgaaccaatcggtgctccagatcagc
agtcaggatgtggagagcaagcgcagcgacaagacggattttgctgagcagcttggtgca
atgaataaaagttggcagctcttgcaaggtcgagtgggtgagaagatccagatgttggag
ggcttgttggagtcgtggtcagagtacgagaacagcatacagtctctgaaagcttggttt
gcaaaccaggagagaaagctggaagagcatcatcaaatcggtgaccagaattctgttcag
aatgctctgaaggactgtcaggaactggaagatttgattaaagcaaaagaaaaggaggta
gagaaaattgagcagaatggactcgcattgattcagaacaagagggaggaggtctcttgc
agtgtcctgaacacactttgggaactcaggcagacctgggccagcttagagcgcacggtt
ggacagttaaagatacagctgacattggtccttggccagtggagcattcacaaagctgcc
tttgaggagatcagcaatcacctcatggaggccagatactctctgtcccgattccgtctg
ctgacaggttcctctgacgctgtgcaagttcaggttgacaatcttcagaatcttcatgat
gacctggaaaagcaggaaggggacttacagaaatttggctctctcaccaaccacctactg
aaggagtgtcacccacctgtggcagaagccctgtccagtaccctgcaggaagtcaatatg
agatggaataacttactggaggagattgccaaacagctgcactccagcaaggccctcctt
cagctctggcagagatacaaggactactcgaagcagtgcgcctctgcagtccagagacaa
gaggaacagaccaatgcactgttgaaggcagccacgagcaaggacatcgctgacgatgaa
gtcgccaagtggattcaggattgcaacgaccttctcaagggactggggacagtcaaggac
tcgcttttcatcctccatgagctaggagagcagcttggacaacaggtggatgattctgca
gccaccaccattcagtgtgagcagctctgcttcagccagcgcctggaggccctggagcag
gcgctttgcaagcagcaagcagtgttgcaggcgggagttgttgactatgaaacatttgcc
aagagcttagaagccttagaggcctggatcgtggaagccgagggcattctccaagcgcag
gatcccactcactcatccgacctctccaccatccaggaaagaatggaggagctgaaggga
cagatgctaaagtttagcagcatggctcctgatttagaccgtctcaatgagttggggtac
cggttacccttgaatgacaaggagatcaaaaggatgcaaaacctcaatcgccactggtct
ctgatctcttctcagaccacagaaagattcagcaagctgcagtcattcttgctccaacac
cagactttcttggaaaagtgcgaaacatggatggaattcttggttcagacggagcacaag
ttggcagtggagatctcaggcaattaccagcatcttttggagcagcagagagcacatgag
ctttttcaagccgagatgttcagccgccagcagatcctacactccatcatcgttgatggg
cagaatcttctagaacaaggtcaagttgatgacagggaggagttcagcctgaagttgaca
ctcctcagtaaccaatggcaaggagtgattcgcagggcccaacagagaagaggtatcatc
gacagccagattcgccaatggcaacgctatagagaaatggcagagaagctccgtaaatgg
ttggttgaggtgtctcatctgcccctgagtggtcttggaagcatcccagtaccactgcaa
caagtgaggacactctttgatgaagtgcagttcaaagagaaggtgttcctgcgccaacaa
gggagctacatcctgacagtggaggctggcaagcagctcctgctctctgctgacagtggc
gccgaggcggccttgcaggctgagctcacagacatccaagagaagtggaagtcagccagc
acgcatctggaggagcagaagaaaaagctggcgtttctgttgaaagactgggaaaagtgt
gagaaagggatagccgattccctggagaagctccgcacgttcaagaagaggctatctcag
cctctacctgaccaccatgaggaactccacgcggagcagatgcggtgcaaggaactggaa
aatgcagttgggaggtggacagatgacctggcagagctagtgctgctgagggaggccctg
gctgcccatctcagtgccgaggacatctccatcctgaaggaacgtgtggagcttctgcaa
aggcagtgggaagagctttgtcaccaggtctccctaagacgacagcaagtgagcgagcgc
ctgaacgagtgggctgtcttcagtgaaaagaacaaggagctatgcgagtggctgacccag
atggagagcaaagtctctcagaatggagacatccttatcgaagagatgatagaaaaactc
aagaaggattatcaagaggaaattgctgtggcccaagagaacaaaatccaactccagcaa
atgggagaacggctcgctaaagccagccatgagagcaaagcctctgagattcagtacaaa
ctcagcaaagtgaacgacaggtggcagcatcttctggatctcatggcggctagggtgaag
aagctcaaggagaccctggtggctgtgcagcagctggataagaacatgggcagtctgagg
atttggctggcccacatggagtcagagctggccaagcccatagtctacgattcttgtaac
tctgaagaaatacagaagaaactgagtgagcagcaggagctgcagagagacattgagaaa
cacagcacaggcgtcgcctctgtcctcaacttgtgtgaggtcctgctgcatgactgtgac
gcctgcgccaccgacgcggagtgtgactccatccagcaggccacgcgcaacctggaccgg
cggtggaggaacatctgtgccatgtccatggagaggagactcaaaattgaagagacatgg
cgactgtggcagaagtttctggatgactattctcgttttgaagactggctggagatctca
gaaaggacggctgcattccccagttcttctggggtgctctatacagttgccaaggaggag
ctgaagaagtttgaggctttccagcggcaggtccacgagagcctgacccaactagagctc
atcaacaaacagtaccggcgcctggccagagagaatcgcacagactccgcctgcagtctc
aggcagatggcccacgggggcaaccagagatgggacgacctacagaagcgggtcacctcc
atcttgcgcaggctcaagcatttcattagccagcgtgaggagtttgagacggcacgggac
agcattctggtctggctcacggagatggatttgcagctcaccaatatcgagcatttttct
gagtgtgatgttcaagctaaaataaagcaactcaaggctttccaacaggagatctcactg
aaccacagtaagatcgagcagatcattgcccagggagagcagctgatagagaagagcgag
ccactggatgctgccgtcatcgaggaggagctggatgaactccgacgctactgccaggag
gtcttcggacgtgtggaaagataccacaagaaactgatccgcctgcctctaccagatgac
catgacctctcggaccgagagctagatctcgaagactccatggctctttcagacctacac
tggcaggacccctctgaagatggcatgccctccccacagccttcttccaacccctccctc
tcccttcctcagcccctccggagtgagcggtcagggagagataccccagccagcgtggac
tccatccctctggaatgggaccacgattatgacctgagtcgagacctggagtcagcatct
cgaactctgccttcagaagatgaagaaggcgaggaggacaaggagttctacctcagggga
gctgttggattgtcaggggatcctacctcactggagtcacagatgaggcaactggacaaa
gctctggatgacagccgctttcagatacagcaaactgcaaatatcctcagaggcaaaact
cccacagggccagacctgggcaccagctacaagggctacatgaaactactcggtgaatgc
agcggcagcatagattctgtgaggagactggagcacaagctggcagaggaagagagcttt
cccggcttcactaaccccaccagcacagagactcagccagctggtgtgattgaccgctgg
gagctcctgcaggcccaggcaatgagcaaggagttgaagatgaagcagaaccttcagaag
tggcagcagtttaattcagacctcaacaacatctgcgcctggctaggagagaccgaggag
gaactggacaggctccagcacctggcgctcagcaccgacatccacaccatcaagtctcac
atcaaaaagctcaaggagctccagaaagccttggaccaccgcaaagccatcatcctctcc
atcaacctctgcagctctgagttcacccaggccgacagcaaggagagccatgacttgcag
gatcgcttatcccagatgaataggagatgggaccgcgtgtgctctctgctagaggactgg
aggggttcgctgcaggatgcactgatgcagtgccaggatttccatgaaatgactcacgct
ttgcttctcctgctggaaaacactgacagaaggaaaaatgaaattgtcccaattgattca
acccttgacccagagacacttcaggaccatcacacgcagctcacgcaaataaagcaggag
cttctgaagtcccagctcagagtggcctcactacagaacatgtctcgccagctcttggtg
aatgctgagggttcagattgtctagaagccaaagaaaaagtccatgtgattggaaatcgg
ctcaagcttctcctgaaggaggtcagccgtcatatcaaggatctggagaagctactaggc
atgtcaagcagtcagcaggatttgtcttcatggtcttctgcagatgaggtggacacgtcg
gggtcagtgagtcctacatcaggaagaagtaccccaaacagacagaaatcgccacgaggc
aaatgtagtctctcacagcctggaccctctgtcagcagcccaaagagcaggtccacaaaa
ggtggctccgattcctccctttctgaaaccaggccagcacgggcaggtcgagatttcttg
ttccgggtcctcagggcagctcttccgattcagctgctcctactactccttatcggactc
acctcccgtgtacccatatcggaagaagactacagctgtgccctctccaacaactttgcc
agatcgttccatcccatgctcagatataccaacggtcctcctcccctctga

DBGET integrated database retrieval system