KEGG   Rattus norvegicus (rat): 499358Help
Entry
499358            CDS       T01003                                 

Gene name
Scd4, RGD1563648
Definition
stearoyl-coenzyme A desaturase 4
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rno01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rno01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:rno03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
1q54
AA seq 381 aa AA seqDB search
MLHLSSVAADSDPALSAFTTGPKLPTSKMTALLPREISSKCGTTTIVDSHSWRHQDGEET
IPFQSEDIRPEMREDIHDPSYQDEEGPPPKLEYVWRNIIFMALLHVGALYGITLVPSCKV
YTWLLGIFYNIVAGLGITAGAHRLWSHRTYKARLPLRLFLIMANTMAFQNDVYEWARDHR
AHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYY
KLAVTLIFITLPTMVPWYFWGETLRHSLCVSTFLRYAVLLNFTWLVNSAAHLYGHQPYDR
SIGARENPLVSVASLGEGFHNYHHAFPYDYSVSEYRWHINFTTFFIDCMAALGLAYDRKR
VSKAAVLARVKRTGDGSHKSS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgctccatctatcctcagtcgctgcagattcggaccctgcactctctgccttcacaaca
ggacccaaacttccgacgagcaagatgacggccctcttgccacgagagatttccagcaag
tgtggcactaccaccattgtagactctcactcctggagacatcaggatggagaggagacg
atacccttccagtcagaagacatccgtcctgaaatgagagaagatatccatgatcccagc
taccaggatgaggaggggcccccacccaagctggagtacgtctggaggaacatcatcttc
atggccctgctgcacgtgggagccctgtacgggatcacactagtcccctcctgcaaggtc
tacacctggctcttgggaatattctataacatagttgccggtttgggcatcacagctggg
gctcatcgcctgtggagccatcgaacctataaagcaaggctgcccctgaggctcttcctc
atcatggcgaacaccatggctttccagaacgatgtgtacgaatgggcccgggatcaccgc
gcccaccacaaattctcagagacacacgccgaccctcacaactcccgccgtggctttttc
ttctctcacgtgggttggctgcttgtgcgcaaacacccggctgtcaaagagaagggcgga
aagctggacatgtctgacctaaaagctgagaagctggtgatgttccagaggaggtactac
aagctggctgtcaccctcatcttcatcaccctgcccacaatggtaccctggtacttctgg
ggtgaaactctccgacacagcctgtgcgtctctactttcctgcggtatgccgtgctccta
aatttcacctggctggtgaacagtgccgcccacctctacggacaccagccctacgacagg
agcattggtgcccgagagaatcccctggtgtcagtggcatctttaggcgagggcttccac
aactaccatcacgccttcccctatgactactctgtcagtgagtaccgctggcacatcaac
ttcaccacgttcttcattgactgcatggctgccctgggcctggcttatgaccggaagaga
gtgtccaaggccgctgtcttagccagggttaaaagaactggagatgggagccacaagagt
agctga

DBGET integrated database retrieval system