KEGG   Rattus norvegicus (rat): 499358Help
Entry
499358            CDS       T01003                                 

Gene name
Scd4, RGD1563648
Definition
(RefSeq) stearoyl-coenzyme A desaturase 4
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    499358 (Scd4)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    499358 (Scd4)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    499358 (Scd4)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    499358 (Scd4)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     499358 (Scd4)
Lipid biosynthesis proteins [BR:rno01004]
 Desaturase
  First
   499358 (Scd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
1q54
AA seq 353 aa AA seqDB search
MTALLPREISSKCGTTTIVDSHSWRHQDGEETIPFQSEDIRPEMREDIHDPSYQDEEGPP
PKLEYVWRNIIFMALLHVGALYGITLVPSCKVYTWLLGIFYNIVAGLGITAGAHRLWSHR
TYKARLPLRLFLIMANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLL
VRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKLAVTLIFITLPTMVPWYFWGETLRHSL
CVSTFLRYAVLLNFTWLVNSAAHLYGHQPYDRSIGARENPLVSVASLGEGFHNYHHAFPY
DYSVSEYRWHINFTTFFIDCMAALGLAYDRKRVSKAAVLARVKRTGDGSHKSS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacggccctcttgccacgagagatttccagcaagtgtggcactaccaccattgtagac
tctcactcctggagacatcaggatggagaggagacgatacccttccagtcagaagacatc
cgtcctgaaatgagagaagatatccatgatcccagctaccaggatgaggaggggccccca
cccaagctggagtacgtctggaggaacatcatcttcatggccctgctgcacgtgggagcc
ctgtacgggatcacactagtcccctcctgcaaggtctacacctggctcttgggaatattc
tataacatagttgccggtttgggcatcacagctggggctcatcgcctgtggagccatcga
acctataaagcaaggctgcccctgaggctcttcctcatcatggcgaacaccatggctttc
cagaacgatgtgtacgaatgggcccgggatcaccgcgcccaccacaaattctcagagaca
cacgccgaccctcacaactcccgccgtggctttttcttctctcacgtgggttggctgctt
gtgcgcaaacacccggctgtcaaagagaagggcggaaagctggacatgtctgacctaaaa
gctgagaagctggtgatgttccagaggaggtactacaagctggctgtcaccctcatcttc
atcaccctgcccacaatggtaccctggtacttctggggtgaaactctccgacacagcctg
tgcgtctctactttcctgcggtatgccgtgctcctaaatttcacctggctggtgaacagt
gccgcccacctctacggacaccagccctacgacaggagcattggtgcccgagagaatccc
ctggtgtcagtggcatctttaggcgagggcttccacaactaccatcacgccttcccctat
gactactctgtcagtgagtaccgctggcacatcaacttcaccacgttcttcattgactgc
atggctgccctgggcctggcttatgaccggaagagagtgtccaaggccgctgtcttagcc
agggttaaaagaactggagatgggagccacaagagtagctga

DBGET integrated database retrieval system