KEGG   Rattus norvegicus (rat): 499391Help
Entry
499391            CDS       T01003                                 

Gene name
Gemin7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:rno03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1
AA seq 143 aa AA seqDB search
MSSFRCIPAIRAWTMQSLPIIPVPVPVLRLPRGPDGFSRGFAPDGRRTILRPEVGEGRIQ
DPPESQEQRARAALRERYLRSLLAMVGHPVSFTLHEGVHVTAQFGATDLDVANFYVSQLQ
TPIGVQAEALLRCSDIISYSFKL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcttcagatgcattccagcaattagggcctggaccatgcagagcctaccaatc
attcctgtgccggtgccggtgctgcgcctccctcggggcccggatggcttcagccgaggc
tttgcccctgatggacgcaggaccatcctgaggccagaagtcggagaaggtcgtattcaa
gatccgccagagtcacaggaacagcgggcccgagccgctctgcgggagcgctacctccga
agcctcctagccatggtgggccaccctgtgagtttcacactgcacgaaggtgtacacgtg
actgcccagtttggtgccacagacctggatgtagctaacttctacgtttcccagctgcag
actcccataggcgtgcaggcggaggccctgcttcgatgtagtgacataatttcctattcc
ttcaagctgtga

DBGET integrated database retrieval system