KEGG   Rattus norvegicus (rat): 499969Help
Entry
499969            CDS       T01003                                 

Gene name
RGD1565588
Definition
similar to calcium binding protein P22
Orthology
K17610  
calcineurin B homologous protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     499969 (RGD1565588)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
4q11
AA seq 247 aa AA seqDB search
CVGFPSPGRRGFPPRAAGETVPSPFLTPGPSLPYSLLPPLRLALPLPEELPSLGSRASTL
LRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIIN
AFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDD
KISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQK
MSIRFLH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
tgtgtcgggtttccctccccgggccgcaggggtttccctccccgggccgcaggagaaaca
gtgccctctcccttcttgacccccggcccttccctcccttattccctcttgccgccgctg
cgtctggcgctgccactcccggaggagctcccgtcactggggtctcgggcctccacgtta
ctgcgggacgaagagctcgaggagatcaagaaggagactggcttttcccacagtcagatc
acacgcctgtacagccgcttcaccagcctggacaaaggggagaacggaactctcagccgg
gaagatttccagaggattccagaacttgccatcaacccactgggggaccggatcatcaat
gccttcttctcagagggagaggatcaggtaaacttccgaggattcatgagaactttggct
catttccgacccattgaggataacgaaaagagcaaagatgtgaatggaccggaacccctc
aacagccggagcaacaaactgcactttgctttcagactttatgacttggataaagatgac
aagatctcccgcgatgagctgttacaggtactgcgaatgatggtcggagtgaatatctca
gatgagcagctgggcagtattgcagacaggaccatccaggaggctgaccaagatggagac
agtgccatatcttttacagaatttgttaaggttttggagaaggtggatgtagaacagaag
atgagcatccgatttcttcactaa

DBGET integrated database retrieval system