KEGG   Rattus norvegicus (rat): 500959Help
Entry
500959            CDS       T01003                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    500959
   01230 Biosynthesis of amino acids
    500959
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    500959
   00051 Fructose and mannose metabolism
    500959
   00562 Inositol phosphate metabolism
    500959
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     500959
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   500959
  Exosomal proteins of bladder cancer cells
   500959
  Exosomal proteins of melanoma cells
   500959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
8q13
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGKKKCLGELICTLNAAKMPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDELIGQKVNHALSE
GLGVIACIGEKLDEREAGITDKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKCNVSEEVAQCTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttccaggaagttcttcgtcgggggcaactggaagatgaacgggaagaagaaa
tgcctgggagaactcatctgcaccctgaacgcagccaagatgccggcagacaccgaggtg
gtttgtgcaccgccaaccgcctacatcgacttcgccaggcagaagctggatcccaaaatt
gctgtggctgcacagaactgctacaaagtgaccaatggggctttcactggggaaatcagc
cctggcatgatcaaagacttaggagctacctgggtggtgctgggacactcggaaagaaga
cacgtctttggggaatcagacgagttgattgggcagaaagtgaaccatgccctatccgag
ggactcggagtgatcgcctgcattggggagaagttagacgaaagggaagctggcatcact
gataaggttgtttttgagcaaaccaaggccatcgcagataatgtgaaggactggtccaag
gtggtcctggcctatgaaccggtatgggccattgggactggcaagactgcaacccctcaa
caggcccaggaagtacacgagaagctccggggatggctgaagtgcaacgtctctgaggag
gtggctcagtgcactcggatcatttatggaggttctgtgactggagcgacttgcaaagag
ctggcaagccagcctgatgtggatggcttcctcgtgggcggtgcatctctcaagcctgaa
ttcgtggacattatcaatgccaaacaatga

DBGET integrated database retrieval system