KEGG   Rattus norvegicus (rat): 501563Help
Entry
501563            CDS       T01003                                 

Gene name
Prkx
Definition
(RefSeq) protein kinase, X-linked (EC:2.7.11.1)
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     501563 (Prkx)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   501563 (Prkx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq22
AA seq 358 aa AA seqDB search
MEPPACAEAAVKDPAARDHDPVDAKISAPAADPLPRTSSQKEGHSLQDWDTIATVGTGTF
GRVNLVKEKTGRRYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFLIKLLWTDHDNR
FLYMLMEFVPGGELFTYLRNRGRFSSVAAIFYATEIVCAIEYLHSKEIVYRDLKPENILL
DREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSG
FPPFFDDNPFGIYQKILACKIDFPRQLDFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRH
RWFRGVEWESVPQRKLKPPIVPKLSSDGDISNFETYPEGELDKTPSVSDEDLETFKNF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagccacccgcttgtgccgaggcggccgtaaaagatcctgcagccagagaccatgac
cccgtggacgcaaagatctcagcgcccgccgcggatcccctacccaggacgtcgtcacag
aaagaggggcactcgttacaagattgggacaccatagccaccgtgggcactggaaccttt
ggccgagtaaacctggtgaaggagaagacaggcaggcgatactgtgccttgaagattatg
agcatcccagatgtcatccgcctgaagcaggaacaacatgtgcagaatgagaaagcagtc
ctgaaggaaataaaccaccccttcctcattaaactgctttggacagaccatgacaaccgc
ttcctgtacatgctgatggagtttgtgcctggtggtgagctgttcacctacctgcgtaat
cgtggccgcttttcctcagttgctgcaatcttctatgccacagagattgtgtgtgccata
gaatacctgcactccaaggaaatcgtatacagggacctgaagcctgaaaacatccttctg
gacagggaaggacatatcaaactcactgacttcggcttcgccaagaaactggtggatagg
acatggactctctgtgggacaccggaataccttgccccagaagttatccagagcaaaggt
catggaagagctgtggactggtgggcattgggcatccttatattcgagatgctgtctggg
tttcccccatttttcgatgacaacccatttgggatttaccagaaaatccttgcatgcaaa
atagatttccccagacaattggatttcacctctaaggacctcatcaagaagcttctggtg
gtagacaggacccggcgcctgggcaacatgaagaatggggcagaagacatcaagcggcac
cggtggttccgaggtgtggagtgggagtccgtgccacagaggaaacttaagccacccatt
gtgcccaagttatccagtgatggtgacatctccaactttgagacttatccagagggtgag
ttggacaagactccttctgtatctgatgaagatctggaaacattcaaaaatttctga

DBGET integrated database retrieval system