KEGG   Rattus norvegicus (rat): 501659Help
Entry
501659            CDS       T01003                                 

Gene name
RGD1561481
Definition
similar to ubiquitin specific protease 12
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     501659 (RGD1561481)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   501659 (RGD1561481)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
16
AA seq 363 aa AA seqDB search
MTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSILQALYFCRPFR
DKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQD
AHEFLNYLLNTIADILQEERKQEKQNGRLRNGDVDSEDNNSTPDPTWVHEIFQGTLTNET
RCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHK
RMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVA
VVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESRDFQ
SRD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacagtctccaaattcgcctccatctgtaccatgggcgccaatgcctcggcattagag
aaagagattggtccagaacagtttccggtcaacgagcactattttggattagtcaatttt
gggaatacctgctactgcaactccattctccaagcactttatttttgtcgtccgtttcgg
gacaaagttctggcatacaagagtcagcccagaaaaaaggaaagcctcctcacctgcctg
gcagacctcttccacagcatagccacccagaagaagaaggtcggcgtgatcccgcccaag
aagttcatcaccagattgcggaaggaaaacgagctgtttgataactacatgcaacaagat
gcccatgaattcttaaattacctactcaatacaattgctgatattctacaagaagaaaga
aagcaggagaagcaaaatggccgattacgtaacggggatgtggacagcgaggataacaac
agcacgccagacccaacgtgggtccacgagatttttcagggaacattaactaatgaaacc
aggtgtcttacttgtgaaactataagcagcaaagatgaagattttttagacctttctgtt
gacgtggaacaaaacacatcaatcactcactgcctaagagggttcagtaacacggagact
ctgtgcagtgaatacaaatactactgtgaagaatgccggagcaagcaggaggcacacaaa
cggatgaaagtaaagaaactacccatgatcctggctctgcacctgaagaggtttaagtac
atggaccagcttcatcgatatacaaagctttcttaccgggtggtgtttcctttagaactc
cgtctgtttaacacttcaggagacgcaaccaaccctgacagaatgtatgacctggtcgct
gttgtggttcactgtggaagtggtcccaatcgaggccattatattgcaatagttaagagt
catgatttttggttgttatttgatgacgacattgtagaaaaaatagacgcacaagctatt
gaagaattctacggactgacatctgacatctccaagaactctgagtctcgggactttcag
tctcgggactga

DBGET integrated database retrieval system