KEGG   Rattus norvegicus (rat): 501831Help
Entry
501831            CDS       T01003                                 

Gene name
Myl10, Myl10-ps1, Mylc2pl, RGD1561258
Definition
myosin, light chain 10, regulatory
Orthology
K12756  
myosin regulatory light chain 10
Organism
rno  Rattus norvegicus (rat)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    501831 (Myl10)
  Cellular commiunity
   04510 Focal adhesion
    501831 (Myl10)
   04530 Tight junction
    501831 (Myl10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    501831 (Myl10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
12q12
AA seq 147 aa AA seqDB search
MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF
TVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEEVKQMF
AAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaccagtcccagattcaggagtttaaagaggccttcactatcatggaccagaac
cgtgatggcttcattgacaaggaggacctgagggacacctttgctgcactgggtcgcata
aacgtcaagaacgaggagttggaagccatggtgaaggaagctcctgggcccatcaacttc
acagtcttcctgaccatgtttggggagaaactcaagggcacggatccagaagagaccata
ctacatgccttcaaagtatttgatactgaaggaaaaggcttcgtcaaggctgacttcatt
aaggaaaagcttatgacccaggctgaccggttcagtgaggaggaggtcaagcagatgttt
gcggccttcccgccagacgtctgtggcaacttagactacaggaatctgtgctacgttatc
acacacggcgaggagaaggactag

DBGET integrated database retrieval system