KEGG   Rattus norvegicus (rat): 501831Help
Entry
501831            CDS       T01003                                 

Gene name
Myl10, Myl10-ps1, Mylc2pl, RGD1561258
Definition
(RefSeq) myosin light chain 10
  KO
K12756  myosin regulatory light chain 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    501831 (Myl10)
  Cell motility
   04810 Regulation of actin cytoskeleton
    501831 (Myl10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    501831 (Myl10)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     501831 (Myl10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 501831
NCBI-ProteinID: XP_003752626
RGD: 1561258
Position
12q12
AA seq 147 aa AA seqDB search
MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF
TVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEEVKQMF
AAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaccagtcccagattcaggagtttaaagaggccttcactatcatggaccagaac
cgtgatggcttcattgacaaggaggacctgagggacacctttgctgcactgggtcgcata
aacgtcaagaacgaggagttggaagccatggtgaaggaagctcctgggcccatcaacttc
acagtcttcctgaccatgtttggggagaaactcaagggcacggatccagaagagaccata
ctacatgccttcaaagtatttgatactgaaggaaaaggcttcgtcaaggctgacttcatt
aaggaaaagcttatgacccaggctgaccggttcagtgaggaggaggtcaagcagatgttt
gcggccttcccgccagacgtctgtggcaacttagactacaggaatctgtgctacgttatc
acacacggcgaggagaaggactag

DBGET integrated database retrieval system