KEGG   Rattus norvegicus (rat): 501907Help
Entry
501907            CDS       T01003                                 

Gene name
RGD1559459
Definition
(RefSeq) similar to Expressed sequence AI788959
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    501907 (RGD1559459)
   00053 Ascorbate and aldarate metabolism
    501907 (RGD1559459)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    501907 (RGD1559459)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    501907 (RGD1559459)
   00860 Porphyrin and chlorophyll metabolism
    501907 (RGD1559459)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    501907 (RGD1559459)
   00982 Drug metabolism - cytochrome P450
    501907 (RGD1559459)
   00983 Drug metabolism - other enzymes
    501907 (RGD1559459)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    501907 (RGD1559459)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     501907 (RGD1559459)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   501907 (RGD1559459)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 501907
NCBI-ProteinID: XP_003751392
RGD: 1559459
Ensembl: ENSRNOG00000042714
UniProt: F1LTB8
Position
14p21
AA seq 530 aa AA seqDB search
MSVKMTAALLLLHLTIFFGSGSGGKVLVWPVEFSHWLNLKIILSELVKKGHEVVVLKPSV
SFSYEVDKTSAIEFESFPSSYSIADVEVIFMDCVNESIYELPKQSFWGYFLMLQKLFERT
SDYSERLCRDAAFNKELMTKLQNSGFDVILADPFTPCGDLLAEILKIPLVYSLRFFPGST
YEKYSGGLPMPPSYVPIAMSELSDRMTFVERVKHMIYVLCFDFWFQVFDEKKWNELYTEV
LGRPTTLSETMAKADIWLIRTYWDLEFPHPVLPNFDFVGGLHCRPAKPLPKEIEDFVQSS
GEHGVVVFSLGSMVGSLTEERANVIAAGLAQIPQKVLWRFEGKKPETLGSNTRLYKWIPQ
NDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQKDNIVHLKTKGAAVRLDFLT
MSSTDLLTALRTVTNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVA
GHDLSWVQYHSLDVIGFLLACVVTVMFILKKCCLFCCQKFTKAGRKKKKE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaaatgacagcggccctgctcctgctccacctgaccatcttctttggctct
gggagtggtgggaaagtgctggtgtggcctgtggaattcagccattggctcaacttgaag
ataatcctaagtgagctggtgaagaagggtcatgaagtagttgtgctgaaaccttcagtt
tccttttcttacgaggtcgacaaaacatctgctattgagtttgagtcgttcccttcatcg
tattccatagctgatgtggaggtgatttttatggactgcgtcaatgagagcatttacgag
ctaccgaagcagtcattttggggatactttttaatgttgcaaaaactttttgaaaggact
tcagattattctgagcgtctctgtagagatgcagcttttaataaagaactcatgacgaag
ctacaaaactctggctttgatgtcatcctggcagatcccttcacaccctgtggtgacctg
ctggccgagattctcaagatacccttagtgtacagtctccgcttctttcctggctccact
tatgaaaagtacagtggaggactcccaatgcctccttcctatgtgcccattgctatgtca
gaattaagcgacagaatgacattcgtggagagggtgaaacatatgatctatgtactttgt
tttgacttttggttccaagtgtttgatgagaagaagtggaacgagctttacactgaagta
ttaggaagacccactacactctcagagactatggcaaaggcagacatatggctcattagg
acctactgggatttggaattccctcaccccgtcttaccaaattttgattttgttggtgga
ctccactgcagacctgccaaacccctgcctaaggaaatagaagacttcgtccagtcatct
ggagaacatggtgttgtggtgttttccctcgggtcgatggtgggaagcctaacagaagaa
agggccaatgtgattgcagcaggccttgcccagattccacagaaggttctttggagattt
gaaggcaagaagccagaaaccttgggctccaacactcgtctgtacaaatggatcccccag
aatgaccttctaggtcatcccaaaaccagagcttttataactcatggtggcaccaatggc
atctatgaggcaatctaccacgggattcctgtggttggcattcctttgtttggagaccaa
aaggacaatattgttcacttgaagaccaaaggagcagcagttagactggactttctcacg
atgtccagtacagacttgctcactgcactgaggacagtcactaatgacccttcctataag
gagaatgccatgagattatcaagaatccaccacgaccagccagtgaaacctctggataga
gccgtcttctggattgagtttgtcatgcgccacaaaggagccaagcaccttcgtgtggca
gggcatgacctcagctgggtccaataccactctctggatgtcattgggttcctgctggcc
tgtgtggtgactgtgatgttcatcctcaaaaagtgttgcctcttttgttgtcagaagttt
acaaaagctggaagaaagaagaaaaaggagtag

DBGET integrated database retrieval system