KEGG   Rattus norvegicus (rat): 502128Help
Entry
502128            CDS       T01003                                 

Gene name
Pom121l2
Definition
POM121 transmembrane nucleoporin-like 2
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    502128 (Pom121l2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
17q11
AA seq 519 aa AA seqDB search
MGSYLGKAGSSPRSSAQGRADPREKPATRQPTRPLYQVHRVQHVHRAQPVRRHRPARRPP
NWDPANPAAFVSEAWRRFPMKSPQNPIMGSLPSDWWESYLKRNIWSLRHPRATWSPVTVK
ISPPERRPRPLFPASRVVNSAGPSEEPPGPCGKEQVLRALLECRKGGARWEEPLFPDSSD
TQRKSATLWSAFKPLLKSGATVSFVARPGSLKRSLHAQSSDPKCKRSSYSSVALLASIHT
RGPLSTKRNAITSSYSSSRDLSESWKRHFSRSSVQTPEWPLKKTGKSPNSHLLVTPSSSG
QINGKIPLLQSGPRHLLTMPCQQGPVVTEEDPTSEGQAVPSNQTTEATTGTATDSIPEIR
AGFQPPLSLNRPSETVLNTCVNPQLESLKNMPAPHGCSLLEHIPSISSDSKPSIASIQAL
PSSPTTPVTDSTWLSSVPQAHRSAVSPHSSVIIPTAPTTQSTLVGVVSSPVLHLPASVLP
VETSAHSALRPIWGSVHNTKGKASVWKMGAGPQRPRKMS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgggcagctacctgggcaaagcagggtcctcgccgcggtcctcagcacaggggcgcgca
gacccacgggagaagcctgcgacccgccaacccactaggcccctctaccaggttcaccgt
gtgcagcatgtccaccgcgcccagcctgtccggagacacaggccggcccggaggccacca
aactgggatcccgccaaccctgccgctttcgtcagtgaggcctggaggcgctttcccatg
aagagtccacagaaccccattatgggctctcttccttcagactggtgggaaagttacctg
aagcgtaatatttggtcccttcgtcaccctcgagccacatggagtccggtgacagtcaag
atctcgcctcctgagcggagaccacggcccttgttcccagcctcaagagtggtgaactcc
gcgggaccttcagaggagccaccaggcccctgtggaaaggaacaggtgctgagggccctc
ctcgagtgcaggaagggtggagccaggtgggaagagcctctgttccctgatagctctgac
actcaaaggaagtcagccaccttatggtctgcctttaagcccctgttgaaaagtggggcc
actgtttcgtttgtggccaggcctgggtctctgaaaaggagcctccatgcccagagctca
gatcctaaatgtaagaggtccagttactcctctgtggccctcttggccagcatacatacc
agaggccccctgagcacgaaaagaaatgctattaccagctcctatagttcttctagagat
ctctcagaatcttggaaaagacatttttccaggtcatcagtccagactccagaatggcca
ttgaaaaagacaggaaaaagtcctaattctcacctcttagtcacgcccagcagctctgga
cagataaatggaaagattcctctactgcaatctggtcctaggcaccttttgactatgcct
tgccagcaaggtcctgttgtcactgaagaggacccaacatcagaggggcaagctgtgcca
agcaaccaaaccacagaagctacaactgggacagccacagactccattccagagatcagg
gctggttttcagcctcccttgtctctcaatcggccttctgagacagttcttaatacgtgc
gtgaaccctcagctggaaagcttaaagaatatgcctgccccacatgggtgctcactgtta
gagcacattccaagcatctcttcagactcaaaaccctcaattgcttccatccaggcatta
ccaagctctcccacaacaccagtcactgattccacctggctttcttcagtccctcaggct
cacaggtctgctgtgtccccacactcatctgtcattatccccacagcacccaccacacaa
agcactttggttggggtggtgagtagtccagttctccatcttcctgcatctgtacttcct
gtggagacttctgctcactcggcattaagaccgatatgggggtctgtgcacaatactaag
ggaaaagcatctgtttggaagatgggagctggacctcagaggccaagaaagatgtcttga

DBGET integrated database retrieval system