KEGG   Rattus norvegicus (rat): 502710Help
Entry
502710            CDS       T01003                                 

Gene name
Kmt2c
Definition
lysine (K)-specific methyltransferase 2C
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    502710 (Kmt2c)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     502710 (Kmt2c)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    502710 (Kmt2c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
4q11
AA seq 5003 aa AA seqDB search
MSSEEDRSAEQQQPPPAPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKKPRSRGK
STVEDEDSTDGLETTETENIVETAEVKEQSVEEDAETEVESSKQPASALQRSVSEDSAHS
LVSVGVEAKISEQLCAFCYCGEKSSLGQGDLKQFRVTPGLTLPWKDQPSNKDVGDSGIAT
CEKIQNYAPRKQRGQRKERSLQQSIVSCVSVSTQTACEDQPGKLWDELSLVGLPDAIDVQ
ALFDSTGTCWAHHRCVEWSLGICQMEEPLLVNVDKAVVSGSTERCAFCKHLGATIKCCEE
KCTQMYHYPCAAGAGTFQDFSHFFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCT
TCGQHYHGMCLDIAVTPLRRAGWQCPECKVCQNCRQSGEDSKMLVCDTCDKGYHTFCLQP
VMKSVPTNGWKCKNCRICIECGTRSSAQWHHNCLICDTCNQQQDNLCPFCGKCYHPELQK
DMLHCNMCKRWVHLECDKPTDQELDSQLKEEYICMYCKHLGAEIDPLHPGNEVEMPELLP
TDDSSGMEIEGTEDEVVFLEQTVNEDVSGHQSPPGIVPDAVQVYTEEPQKSDPLESPDTV
GLITSESSENKTNPDLANEISHEVDTEKTEMFYKEGLVCEEDQSEDRMEVTENIEVLPHQ
TIVPQEELLPSEGSEVAPEEPSPSESAVELAAPEALVSPHSESSLSHKGPLVIERVQEEM
EQKENSEFPTGCEDFEMTLAVDGCVKGSSCQGDKSAELPAEEESPFSSGTDLNKADVSSS
STLRPDLPSCDMLHGYPSAFNSAAGSVMPTTYISVTPKIGMGKPAITKRKFSPGRPRSKQ
GAWSNHNTVSPPSWSPDIAEGREIFKPRQLSGSAIWSIKVGRGSGFPGKRRPRGAGLSGR
GGRGRSKLKSGLGAVVLPGVSAADISSNKDEEENSMHNTVVLFSSSDKFTLHQDMCVVCG
SFGQGEEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATDPGRLLL
CDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASL
SSCPVCCRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVADIGFDCSMCRPYMPVSN
VPSSDCCDSSLVAQIVTKVKELDPPKTYTQDGVCLTESGMSQLQSLTVTAPRRKRTKPKL
KLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELMDCDGKSESSPEREAGDDETKGI
EGTDGVKKRKRKPYRPGIGGFMVRQRSRTGQGKAKRSVVRKDSSGSISEQLSNRDDGWRE
QFPDTLVDEPVSVADSTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDLLDTSRQNKLSVD
NLSEDAAQLSYKTGFMDPSSDPLLCSSSASAKPGTQGTADDPLADISEVLNTDDDILGII
SDDLAKSVDHSGLDLCTFQVGSSPFPLDIGPIADDASSLPQPSVSQSSRPLSEEQLDAIL
SPELDKMVTDGAILGKLYKIPELGGKDVEDLFTAVLSPAPTQPAPLPQPPPPQPLPVHTQ
DVFSRMPLMNGLIGPSPHLPHHSLPAGSALGTFPAIAQSPYTDVRDKSLAFNVMASDANS
SWVPTAPSMEGENDSLSNAQRSTLKWEKEEALGEVATVAPVLYTNINFPNLKEEFPDWTT
RVKQIAKLWRKASSQERAPYVQKARDNRAALRINKVQMSNDSMKRQQQQDSIDPTSRIDS
DLFKDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQQQQQQQ
QQQQQQQQQQQQLASQHLLVAPGSDPPSSGAQSPLTPQTGNGSVSPAQTFHKDLFSKHLP
STPASIPSDDVFVKPQPPPPPSTPSRIPNQESLSQSQNSQPPSPQMFSPGSSHSRPPSPV
DPYAKMVGTPRPPPVGHSFPRRNSVTPVENCVPLSSVPRPIHMNETSATRPSPARDLCAS
SMTNSDPYAKPPDTPRPMMTDQFPKPFSLPRSPVISEQSTKGPLAAGASDHFTKPSPRTD
AFQRQRLPDPYAGPSLTPAPLGNGPFKTPLHPPPSQDPYGSLSQASRRLSVDPYERPALT
PRPVDNFSHNQSNDPYSQPPLTPHPAMGESYTHSSRAFSQPGTISRSASQDPYSQPPGTP
RPVIESYSQTSGTARSNQDPYSQPPGTPRPNTIDPYSQQPPTPRPSPQTDMFVTSVASQR
HTDPYTHHLGPPRSGISVPYSQPPAAPRPRTSEGFTRSSSARPALMPNQDPFLQAAQNRV
PGLPGPLIRPPDTCSQTPRPAGPGLTDTFSHASPSGVRDPYDQPPMTPRPHSESFGASQV
VHDLVDRPVPGSEGNFSTSSNLPVSSQGQQFSSVSQLPGPVPTSGGTDTPNTVNMSQADT
EKLRQRQKLREIILQQQQQKKIASRQEKGPQDTAVVPHPLPLPHWQPESINQAFTRPPPP
YPGNTRSPVIPPLGPRYAVFPKDQRGPYPPEVAGVGMRPHGFRVGFPGASHGPMPSQDRF
HVPQQIQGSGIPPNIRRPMSMEMPRPSNNPPINNPVGLPQHFPPQGLPVQQHNILGQAFI
ELRHRAPDGRSRLPFAASPGSAMESPSHPRHGNFLPRPDFPGPRHTDPIRQPPQCLPNQL
PVHANLEQVPPSQPEQGHPAHQSSIVMRPLTHPLSGEFSEAPLSTSTPTETPPDNLEIAG
QSSDGLEEKLDSDDPSVKELDVKDLEGVEVKDLDDEDLENLNLDTEDGKGDDLDTLDNLE
TNDPNLDDLLRSDEFDIIAYTDPELDLGDKKSMFNEELDLNVPIDDKLDNQCVSVEPKIR
DQGDKTMVLEDKDLPQKKSSGISEIKTEALSPHSKEEPESDIKNCDDSRGDAEIACSQAS
GQTSHSDRGKPSLLTTDQEMLEKRNNRENAAPGVCAIQESTPLPAQDVMNSCDITGSTPV
LSSLLSNEKCDSSDIRPSVSSPPTLPISPSTHGSSLPPTLIPPGPLLDNTMNSNVTVVPR
VNHAFSQGVPVNPGFLQGQSSVNHLGTGKPTNQTVPLTNQSSTSGMPGPQQLMMPQTLAQ
QSRERPLLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKA
KMVALKGINKVMAQNSLGMPPMVMSRFPFMGPSMAGVQTSEGQTLMPQAVAQDGSITHQI
SRPNPPNFGPGFVNDSQRKQYEEWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTA
KKAGREFPEEDAEQLKHVTEQQSMVQKQLEQIRKQQKEHAELIEDYRIKQQQQQQQQQQQ
QQQQQQQQQQCALAPPILMPGVQPQPPLVPGASPLTMSQPNFPMVSQQLQHQQHTAVISG
HTSPARMPGLPGWQSSSAPAHLPLNPSRIQPPTAQLSLKTCTPAPGAVSSANPQNGPPPR
VEFDDNNPFSESFQERERKERLREQQERQRVQLMQEVDRQRALQQRMEMEQHGLMGAELA
NRTPVSQMPFYASDRPCDFLQPPRPLQQSPQHQQQIGPVLPQQTVQQGSVNSPPNQTFMQ
TNERRQVGPTPFVPDSPSASGGSPNFHSVKQGHGNLSGSSFQQSPLRPPFTPILPGKPPV
ANSSVPCGQDPAVTAQGQNFSGSSQSLIQLYSDIIPEEKGKKKRTRKKKKDDDAESSKAP
STPHSDCTAPPTPGLSETTSAPAVSTPSELPQQRQQEAVEPVRVPTPNVATGQPCIESEN
KLPSSEFIKETSSQQTPVSSEADKPSGEASNKSEERKLETAEIQPCPSQEDTKVEEKTGS
KIKDTAAGPVSSIQCPSNPARTPVTKGDTGNELLKHLLKNKKASSLLTQKPEGTLSSDES
STQDGKLVEKQNPAEGLQTLGAQMQGGFGGGNSQLPKTDGGSETKKQRSKRTQRTGEKAA
PRSKKRKKDEEEKQAVCSSSDSFTHLKQQLSLLPLMEPIIGVNFAHFLPYGSGQFNSGTR
LLGTFGSAALEGVSDYYSQLIYKQNNLSNPPTPPASLPPTPPPMACQKMANGFATTEELA
GKAGVLVSHEVTRALGPKPFQLPFRPQDDLLARAIAQGPKTVDVPASLPTPPHNNHEELR
IQDHYGDRDTPDSFVPSSSPESVVGVEVNKYPDLSLVKEEPPEPVPSPIIPILPSISGRD
SESRRNDIKTEPGTLFFTSPFGSSPNGPRSGLISVAITLHPTAAENISSVVAAFSDLLHV
RIPNSYEVSSAPDVPSMGLVSSHRINPGLEYRQHLLLRGPPPGSANPPRLATSYRLKQPN
VPFPPASNGLSGCKDSSHGIAEGTSLRPQWCCHCKVVILGSGVRKSFKDLTFANKGSRES
TRRTEKDIVFCSNNCYILHSTTAQAKISDNKEPLPSLPQSPMKEPSKAFHQYSNNISTLD
VHCLPQFQEKVSPPASPPITFPPAFEAAKVESKPDELKVTVKLKPRLRTVPVGLEDCRPL
NKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFCHEE
GDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKT
GATSGCHRFRCTNIYHFTCATKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQ
RDEVRQIASIVQRGERDHTFRVGSLIFHAIGQLLPQQMQAFHSSKALFPVGYEASRLYWS
TRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDSSPKDVWDKILEPVACVRKKS
EMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAVNPTGC
ARAEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRRMKTE
WKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFR
MDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKF
DFEDDQHKIPCHCGAVNCRKWMN
NT seq 15012 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggaggaggaccggagcgcggagcagcagcagccgccgccagcaccccccgag
gagcccggagccccggccccgagccccgcagccgcagacaaaagacctcggggccggcct
cgcaaagatggcgcttcccctttccagagagccagaaagaagcctcgaagtagaggaaaa
tctacagtggaagatgaggacagcacggatggactggagacgacggagacagaaaatatt
gtggagacagcagaagtcaaagaacaatctgtggaggaggacgctgagacagaagtggag
agcagcaagcagccagcctcagctcttcagcggtctgtgtctgaggactctgcacactcc
ctggtctctgtcggtgtagaagccaaaatcagtgaacagctctgcgccttttgttactgt
ggggagaaaagttccttaggacaaggagacttgaaacaattcagagtaacacctggactt
actttaccttggaaagatcaaccttctaacaaggacgtcggtgacagcggcattgcaacc
tgtgagaaaatacagaactacgctccacgaaaacagcgaggacagagaaaagagcgatct
ctccagcagagtattgtttcttgtgtaagtgtaagcacgcagacagcttgtgaggaccag
cctggcaagttatgggatgaactcagtctggttggccttccagatgccattgatgtccaa
gccttatttgattccacaggcacttgctgggctcatcatcgatgtgtagagtggtcactg
ggaatatgccaaatggaagagccattattagtgaacgtggacaaagctgttgtctcaggg
agcacagaacgttgtgcattttgcaaacaccttggagccactatcaaatgctgtgaagag
aagtgtacccagatgtaccattacccgtgtgctgcaggggccggcacctttcaggacttc
agtcacttcttccttctgtgtccagagcacatcgaccaagctcctgagagatcaaaggaa
gatgcaaactgtgcagtgtgtgacagcccgggagatctcttagatcagttcttttgtacc
acctgtggtcagcactaccatgggatgtgcctggacatagctgttactccattaaggcgt
gctggttggcaatgtcctgagtgcaaagtgtgccagaactgcagacaatcgggagaagat
agcaagatgctggtgtgtgatacttgtgacaaagggtatcatactttttgtctccaacct
gttatgaaatcagtgccaaccaatggctggaaatgcaaaaattgcagaatctgtatagaa
tgtggcacacgatctagtgctcagtggcaccacaactgtctgatatgcgacacttgtaat
cagcagcaagataatttatgtcctttttgtgggaagtgctaccatccagaattgcagaaa
gacatgctccactgtaatatgtgtaagagatgggttcacttagaatgtgacaaaccaact
gatcaggaattggattctcagctcaaagaagaatacatctgcatgtactgtaaacactta
ggagctgagatagatcccttacatccagggaatgaagtggagatgcctgaacttctaccc
acagatgattccagtggaatggaaattgaaggcactgaagatgaagtggtgtttctggag
cagacagttaatgaagatgtcagtggtcaccagtcccctcctggaattgttccagatgca
gttcaagtttacactgaagagccccagaaaagtgatccactagaaagccctgacacagtt
ggtctcattacttctgaatcatctgagaataaaaccaatcctgatttggcaaatgagatt
tctcatgaagttgatactgaaaaaacggaaatgttttataaagaggggcttgtttgtgag
gaagatcaaagtgaggacagaatggaagtgacagaaaacattgaagtccttccacaccaa
accattgtgccgcaagaggaactgctgccctccgagggctctgaggtggcacctgaggag
ccaagcccttcagagtcagctgtggagcttgctgcaccagaagccttagtgtccccacac
agtgaaagttccttatctcataagggaccgttggtgatagaaagagtacaagaagaaatg
gaacagaaggaaaattctgaattccccactgggtgtgaggattttgaaatgactcttgct
gttgacggttgtgtcaaaggtagttcatgccaaggagacaaatcagctgagttaccagct
gaggaagagtcaccattctcatcaggaactgacctgaacaaggcggacgtgtcttcctcc
tccacacttcgtccagacttgccttcatgcgacatgctgcacggttacccttcagctttc
aactctgctgctggaagcgtcatgccaacaacatacatctctgtcactccaaaaattggc
atgggtaaaccagctattaccaaaagaaaattttctcccggtagaccccggtccaaacag
ggggcttggagtaaccataatacagtgagcccaccctcctggtccccagacattgcagaa
ggccgggaaatttttaaacccaggcagctttctggcagtgccatttggagcatcaaagtg
ggccgagggtctggatttccggggaagcggaggcctcgtggtgctgggctgtcagggcga
ggcggcagaggcagatctaaactaaaaagtggactcggagctgttgtgttacctggggtg
tctgctgcagatatttcatcaaataaagatgaagaagaaaactctatgcacaatacagtt
gttttattttctagtagtgacaagttcactttgcatcaggatatgtgtgtagtttgtggc
agtttcggccaaggagaagaaggaagattacttgcctgttcacagtgtggtcagtgttac
catccatattgtgtcagtattaagatcactaaagtggttcttagcaaaggttggagatgt
cttgagtgcactgtgtgtgaggcctgtgggaaggcaactgaccctggaagactcttgctg
tgtgatgactgtgacataagctatcatacctactgcctagaccctccattgcagacagtt
cccaaaggaggctggaaatgcaaatggtgtgtttggtgcagacactgtggagcaacatct
gcaggcttgagatgtgaatggcaaaacaattacacacagtgtgctccgtgtgccagcctg
tcctcctgcccagtctgctgtcggaactacagagaagaggacctcattcttcagtgtaga
cagtgtgataggtggatgcatgcagtttgtcaaaacttaaatactgaggaggaagtggaa
aatgtagcagacattggttttgactgtagcatgtgcagaccctatatgcctgtgtcaaat
gtgccttcctcagactgctgcgactcttctcttgtggcacagatcgtcacaaaagtaaaa
gagctagacccacctaagacctacacccaggacggtgtgtgtctgaccgagtcagggatg
agtcagctacagagcctcacagtcacagctcccaggagaaaacgcacaaaaccaaaactg
aaattgaagattataaatcagaatagtgtggctgttcttcagacccctccagatatccag
tcagaacactcaagagacggagaaatggacgatagtcgagaaggagaacttatggattgt
gatgggaaatctgaatctagtcctgagcgggaagctggagatgatgaaactaagggaata
gaaggaacagatggcgtaaagaagaggaaaagaaaaccatatagacctggtattggtgga
tttatggtacggcaaagaagtcggacaggacaaggaaaagccaaaagatctgtggtcaga
aaagattcttcaggctctatttctgagcagttatctaacagagacgatggctggagggag
cagttcccagatactctggtggatgagcctgtctccgttgctgacagcactgagaaaata
aagaagagataccgaaaaaggaaaaataagcttgaagaaacttttcctgcttatttacaa
gaagcattttttggaaaagatcttctagataccagcagacaaaacaagctgagtgtagat
aatctgtccgaagacgcagctcagctttcatataaaacaggtttcatggatccttcctca
gatccgctgctgtgttcatcatctgcttcagcaaaacctgggactcagggtactgctgat
gacccattagctgatatttctgaagtcttaaacacagatgatgacattcttggaataatc
tcagatgatcttgcaaaatcagttgatcattcaggtcttgatttatgcactttccaggtt
gggagctcccccttccctttggatattggccccattgctgatgatgcttcctctttgcct
cagccaagtgtcagtcagagttcacgaccattaagtgaagaacagctagatgccatcctc
agtcctgaactagacaaaatggtcacagatggagcaatacttggaaagttatataaaatt
ccagagcttggaggaaaggatgttgaagacttgttcactgctgtacttagtcctgccccc
acccagccggctccattgccacagccccctccaccacagccactgccagtgcacactcag
gatgttttttcccggatgccactcatgaatggccttattggacccagtcctcatctccca
catcattctttgcctgctggaagtgcactggggactttccctgctatagcacaatcccct
tatactgatgtcagggataaaagtctagcatttaatgtaatggcaagtgatgctaacagc
tcctgggtgccgacagctccaagtatggagggggaaaacgacagcctgtcaaatgcccag
aggagcacactgaagtgggagaaggaggaggctcttggtgaggtggcaacagtggcacca
gtcctctacacaaatattaatttccccaacttaaaggaagaattcccagattggactact
cgagtgaaacaaattgccaagttgtggagaaaagccagctctcaggaaagagcgccatat
gtgcaaaaagccagagataacagagctgctttacgcatcaataaagttcagatgtcaaat
gattctatgaagaggcaacaacagcaagacagcatcgatcccacctcacgcatcgattcg
gatctttttaaagatcctttaaagcagagggaatcagagcatgaacaggaatggaagttt
agacagcaaatgcgtcagaaaagtaagcagcaagctaaaattgaagccacacagaagctg
gaacaagtgaagaatgaacagcagcagcagcagcagcaacagcaacaacaacaacaacaa
caacaacaacaacaacaacaacagcaacaacaacaacttgcttctcagcaccttctagta
gcacctggttcagatcctcccagtagtggagcacagagtcccttgacacctcagactggc
aatgggagtgtgtctcctgcacagacattccataaagacctgttctccaaacacctcccc
agtactcctgcttccataccttcagatgatgtgtttgtcaaaccacaacctccaccccct
ccttcaaccccatcccgtatacctaatcaggaaagtctgtctcagtcccagaattctcag
ccaccttctccacagatgttctcacctggatcatcccactccagaccaccctctccagtg
gatccttatgcaaaaatggttggtactcctagaccgcctcctgttggccatagttttcca
agaagaaattctgttacaccagtggaaaactgtgtgcctttatcttcagtacctaggccc
attcatatgaatgaaacatcagccacaaggccatccccagccagagacttatgtgcttcc
tccatgacaaacagtgacccctatgcaaagcctccagatacacctaggccaatgatgaca
gatcagtttcccaaaccttttagccttcctaggtcccctgtgatttcagaacaaagtaca
aaaggtcctcttgcagctggagccagtgatcactttaccaagccttctcctagaacagac
gcctttcagaggcaacggctgcctgacccatatgcagggccatcgttgacacccgcccca
ctgggtaatgggccgtttaagacccctctgcaccctcctccatctcaggatccatatgga
tctttgtcacaggcatcaagacgactctctgttgacccttatgaaaggcctgccttgaca
ccaaggccagtagataatttttctcataatcagtcaaatgatccatatagccagcctccc
ctaactccacacccagctatgggtgaatcttatactcactcttcaagggctttttctcag
cctggaaccatatcaaggtcagcatctcaggacccatattcacaacccccaggaactcca
cgtcctgttatagaatcttactcccaaacctcaggaacagctcgatccaatcaagatcct
tattcccaacctcctggtactccccggcctaacactattgacccatatagtcagcaacca
cctacccctaggccttctccacagacagatatgtttgttacgtctgtggcaagtcagaga
cacactgatccatatactcatcatcttgggccgccgagatctggaatttctgttccctat
tctcagccaccagcagcaccaaggccaaggacttcagagggttttactcggtcctctagt
gcaagaccagccctcatgccaaaccaggatccttttttgcaagcagcacaaaaccgagta
ccaggtttacctggccctttaataaggccacctgatacatgttcccagactcccagacca
gctgggcctggccttacagacacattcagtcatgcttccccatctggtgttcgtgatccc
tacgatcagcctccaatgactcccaggccacattctgagtctttcggggctagtcaagtt
gtccacgatcttgttgaccgtccagttcctggatcagagggaaactttagcacatcttca
aaccttcctgtaagctcccaaggacagcaattttccagtgtctcccagcttcctggaccc
gtgccaacctcaggaggaactgacacaccgaacaccgtgaacatgtctcaagctgacacc
gagaaattgagacagcggcagaagctgcgtgaaatcattctccagcaacagcagcagaag
aagattgctagtcgccaggagaaggggcctcaggacacagccgtagtacctcaccctctg
ccccttccacactggcagccagagagcatcaaccaggctttcacccgacctccacctccc
tatcctgggaacactcgatcacctgttatccccccactaggacctagatatgcagttttc
cccaaagatcagcgtggaccctatcctcctgaggttgctggtgtggggatgagacctcat
ggatttagagttggatttccaggagctagccatggtcccatgccaagccaagatcgtttc
catgtgcctcagcaaatacaaggatctggaattcctccaaacataagaagaccaatgtct
atggaaatgcctagaccttcaaataacccaccaataaataatccagttgggcttcctcag
catttcccaccacagggtctgccagttcagcagcataatatactaggccaagcttttatt
gagctgaggcacagagctccggatggaaggtcacggttgccatttgctgcttctcctggc
agtgctatggagtcaccttctcatcccagacatggaaatttccttcccagacctgatttt
cctggtcctagacacacagaccccataagacaacctccccagtgtctacctaatcagcta
cctgtgcatgcaaatttagagcaggtcccaccttctcagccagagcaaggtcatcctgcc
caccaatcttctattgtcatgaggcccctaactcatcctttaagtggtgaattttctgag
gctcctttgtcaacatctaccccaactgaaacacccccagataacttagagatagctggt
cagtcttctgatggtctggaggaaaaactagactctgatgatccttctgtgaaagaactg
gatgtcaaagatcttgagggagtcgaagtcaaagatttggatgatgaagatctagaaaat
ttaaatttagacacagaggatggcaagggtgatgacctggacactttagataatttggaa
accaatgaccctaacctggatgacctcttaaggtcagatgaatttgatatcatagcgtac
acagatccagaacttgacttaggggataaaaaaagcatgttcaatgaggaattagacctt
aatgttccaattgatgataagctagataatcagtgtgtatctgttgaacccaaaataagg
gatcaaggagacaaaactatggttcttgaagataaggatttgccacagaaaaagtccagt
ggtatcagtgagataaagacagaagccctgtctccccactctaaagaagaaccagagagt
gacattaaaaactgcgatgacagtagaggagatgccgagatagcgtgctcacaggcttct
ggtcagaccagtcacagtgatcgaggaaagccttctctgctgactactgatcaagagatg
cttgagaaaagaaataaccgggaaaatgcagctcctggtgtctgtgccattcaagagtcc
actcctctgcctgctcaagacgtgatgaactcttgtgacataacaggatcgactccagtt
ctctcgagtttactctcgaatgaaaagtgtgatagctctgacattaggccttcagtgtct
tccccaccaactctccccatctcaccatccactcatgggtcaagtttgcctcctacttta
ataccacctggccctctcttggataataccatgaattctaatgtaacagtggtccctagg
gtaaaccatgcattttctcagggtgtgccagtaaatccaggattccttcagggtcagtca
tcagtgaaccatttagggacagggaaacctacgaatcaaactgtgcctctcacaaatcag
tccagcaccagtggcatgcctggaccacagcagctaatgatgcctcaaacattagcccag
cagagcagagagaggcccctccttctagaggaacagcctctgcttctacaagatcttttg
gatcaagagaggcaggagcagcagcagcaaagacaaatgcaagctatgattcgtcagcgg
tcagaaccattcttccctaacattgatttcgatgcaataacagatcctataatgaaagcg
aaaatggtagcccttaaaggcataaataaagtgatggcacagaacagcctgggcatgcca
ccaatggtgatgagcagattccccttcatgggtccatccatggctggagtgcaaaccagt
gaaggccagaccctaatgccacaagctgtagcccaggatggcagtataacacatcagatt
tctaggcctaatcctccaaattttggtccaggctttgtcaatgactctcagcggaagcag
tatgaagagtggctccaggagactcagcagctgcttcagatgcagcagaagtatcttgag
gaacaaattggtgcgcacagaaaatctaagaaggccctgtcagccaaacagcgcacggcc
aagaaggcagggcgagagttcccagaagaggacgcagagcagctcaagcatgttactgag
cagcagagcatggttcagaaacaacttgagcagattcgtaaacaacagaaagagcatgct
gagctgattgaagattaccggatcaagcagcagcagcagcagcagcagcagcagcagcag
cagcagcagcagcagcagcagcagcagcagtgcgccctagcccctcccatcctcatgcca
ggggttcagccccagccacctctagttccaggtgccagcccactcaccatgagccaaccc
aacttccccatggtgtcacagcagcttcagcaccagcagcacacagcagtcatctctggg
cacaccagccctgctagaatgcccggcttacctggatggcaatctagcagtgctcccgct
cacctcccccttaacccttctaggattcagcccccaactgcccaactatctttaaaaact
tgtacaccagccccaggggcagtgtcaagtgcaaatccacagaatggaccaccacctcga
gtagaatttgatgacaacaaccctttcagtgaaagttttcaagagcgagagaggaaggaa
cgcttacgagaacagcaggaaagacagcgagtgcagctgatgcaagaagtagacagacag
agagctctacagcagcggatggagatggagcagcatgggcttatgggtgctgagctagcc
aacaggacacctgtttcccagatgccattctatgcttctgacagaccttgtgactttttg
caacccccacgaccccttcagcagtctccacaacaccagcagcagatagggccagtttta
ccacagcagactgtccaacaagggtctgttaattcacccccaaaccaaactttcatgcaa
accaatgagcgaaggcaggtaggacctaccccctttgttccagattcaccatctgcttct
ggtgggagcccaaacttccattctgttaagcaaggacatggaaatctttctggatccagc
tttcagcagtctccactgaggcctccattcacaccaattttaccaggaaagcctccggta
gccaatagcagtgtcccatgtggccaagaccctgctgtaacagcacagggacaaaatttt
tcaggatccagccagtctctcattcagttgtattctgacataatcccagaagaaaagggg
aaaaagaagagaacaagaaaaaagaaaaaagatgatgatgcagaatccagcaaagcccca
tcaactccccactccgactgcacagccccaccaaccccaggcctctcagaaactacctct
gctcctgcagtgagcacacccagtgagctccctcagcaaagacaacaggaggcagtggag
cccgtccgtgtccccactccaaatgtggcaacaggccagccttgtatcgagtcagaaaac
aaacttcccagcagtgaattcataaaagaaacttcaagtcaacagacacctgtgagctca
gaggcagacaaaccttccggggaggcctccaacaaaagtgaagagagaaagctggagacg
gctgagatacagccatgcccaagtcaggaggacaccaaagtggaagagaaaactggtagt
aagatcaaagacactgcagctggtcctgtctcctccatacagtgtccttccaatcctgcc
agaacccctgtcaccaaaggagacacaggaaacgaactactgaagcacttgttaaaaaat
aagaaggcctcttcccttctcactcagaaacctgagggcactttatcttcagatgaaagc
tctacacaggatggtaaactggtggagaagcagaatccagcagaaggattgcaaactttg
ggggctcaaatgcaaggtggttttggaggtggcaacagccagttgccaaaaacagatgga
ggaagtgaaaccaagaaacagcgaagcaaacggacacagaggacgggggaaaaagcagca
cctcgctcaaagaaaaggaagaaggatgaagaggaaaagcaggctgtgtgctccagctct
gactccttcacccacttgaaacagcagctctctctgctccctctaatggaaccgatcatt
ggagtgaactttgcgcactttcttccttatggcagtggccaatttaatagtgggactcga
cttctaggaacttttggcagtgccgcccttgaaggggtctcagactactattctcagttg
atctacaagcagaataatttaagtaatcctccaacaccccctgcctctcttcctcctaca
ccacctcctatggcttgccagaagatggcaaatggttttgcaacgactgaagaacttgct
ggaaaagctggcgtgttggtgagccacgaagtcaccagagctttaggaccgaagccattt
cagctgcctttcagacctcaggatgacttgctagctcgagccattgctcaaggcccgaag
acagtggatgttcctgcctctcttccaacaccacctcacaataatcatgaagaattaagg
attcaggaccactatggcgaccgggacactccagacagtttcgtcccctcgtcttctcct
gagagtgtagttggtgtggaggtgaacaagtaccccgacctgtcactggtgaaggaggag
cctcccgagcctgtgccatcccccatcattcccattctccccagcatctctgggagagat
tcagaatcaagaagaaatgacatcaaaactgaaccaggcactttattttttacatcacct
tttggttcatccccaaatggtcccagatcgggtcttatatctgtggcaatcaccctgcat
cctacagctgctgagaacattagcagtgttgtggctgcgttttccgaccttcttcacgtg
agaattcctaacagctatgaggttagtagtgctccagatgttccatccatgggtttggtc
agtagccacagaataaacccaggtttggagtatcggcagcatttgcttcttcgtgggcct
ccaccaggatctgcaaatcctccccgattagcaacctcttaccggctgaagcagcctaat
gtaccatttcctccagcgagcaatggactttctggatgtaaagattctagtcatgggata
gcagaaggcacatcactccggccacagtggtgctgtcactgtaaagtggtcattcttgga
agtggtgtgcggaaatcattcaaggatctgacctttgcgaacaagggttcccgagagagc
accagaaggacggaaaaggacattgtcttttgtagtaataactgctatattcttcattca
acaaccgcacaagcaaaaatttcagacaacaaggaaccccttccgtcactgccacagtcc
cctatgaaggagccttccaaagcatttcaccagtatagcaacaacatctccaccttggat
gtacactgtctccctcagttccaggagaaagtctcccctcctgcatcacctcctataacc
ttccctccagcctttgaagccgccaaagtagagtccaagcctgacgagctcaaggtgaca
gtcaaattaaagcctcggctgaggacggtgcctgtcgggctggaggattgtagaccactg
aataaaaagtggagagggatgaagtggaagaaatggagcattcatattgtcatccccaag
gggacctttaaaccgccctgtgaggatgagatagatgaatttctaaagaaattgggcact
tcccttaaacctgaccctgtccccaaagactatcgcaagtgttgcttttgtcacgaagaa
ggtgatgggctaacagatgggccagcaaggctgctcaacctggacctggacctctgggtc
cacttgaattgtgctctgtggtccacagaggtctatgagacacaggctggtgccttaata
aatgtggagctagcgctgaggagaggtctacaaatgaaatgtgtcttctgtcataagaca
ggtgccaccagtggatgtcacagatttcgatgtaccaatatttatcattttacttgcgcc
actaaagcacaatgcatgttttttaaagacaaaacaatgctttgccccatgcacaaacca
aagggaatccatgagcaagaattgagttactttgcagtcttcaggagggtctatgtgcaa
cgagatgaggtacggcaaattgctagtattgtgcaacggggagagcgggaccataccttt
cgtgttgggagcctcatcttccatgccattggtcagctgcttccacaacagatgcaagca
ttccactcttcgaaagcgctcttccccgtgggctatgaggccagccggttatactggagt
actcgctacgccaaccgtcgatgccggtacctgtgttccattgaggagaaagacgggcgg
cccgtgtttgtcatcaggattgtagagcaaggccatgaggacctggtcttaagtgattca
tcacctaaagatgtttgggataaaattttggagcctgtggcatgtgtaagaaaaaagtcg
gaaatgctgcagcttttccccgcgtatttgaaaggagaagacctgtttggcctgactgtc
tctgcggtggcacggatagctgagtcactacctggggttgaggcatgtgaaaactacacc
ttccggtatggccgcaatcctctcatggaacttcctcttgccgttaaccccacaggctgt
gcccgtgcggaacctaaaatgagcgcccatgtgaagaggtttgtgttaaggcctcacacc
ttgaatagcaccagcacttcaaagtcgtttcagagcacagtcactggagagctgaacgca
ccgtacagtaagcagtttgtccactccaagtcatcacagtaccgcagaatgaagactgaa
tggaaatctaatgtgtatctggcccggtctcggatccagggactgggcctgtatgctgct
agagacattgaaaaacacaccatggtcatcgagtacattggaacgattattcgaaatgaa
gttgcaaaccggaaagagaagctttatgagtctcagaaccgaggtgtgtacatgttccgc
atggacaatgaccacgtgattgatgccacactcacaggagggcctgcaaggtacatcaac
cactcctgtgcccctaactgtgtggctgaagttgtgacctttgagagaggacacaagatt
atcatcagctccaacaggaggatccagaaaggagaagagctctgctatgactacaagttt
gactttgaagatgaccagcacaagatcccatgtcactgtggagcggtgaactgccggaag
tggatgaactga

DBGET integrated database retrieval system