KEGG   Rattus norvegicus (rat): 502969Help
Entry
502969            CDS       T01003                                 

Gene name
Cyp2j16, RGD1561242
Definition
cytochrome P450, family 2, subfamily j, polypeptide 16
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    502969 (Cyp2j16)
   00591 Linoleic acid metabolism
    502969 (Cyp2j16)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    502969 (Cyp2j16)
  Nervous system
   04726 Serotonergic synapse
    502969 (Cyp2j16)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    502969 (Cyp2j16)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     502969 (Cyp2j16)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   502969 (Cyp2j16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
5q33
AA seq 503 aa AA seqDB search
MLATVGSLLAKIWSAINFWTLLLTLLTFLLLADYLKNRRPNNYPPGPWRLPFVGNLFQFD
LNISHLHLRIQQFVKKYGNLISLDFGNISVVVITGLPLIKEALINNEQNFLKRPIVPSRY
RVFKDNGIFFANVHKWKEQRRFALTMLKNFGLGKKSLEQCIQEEAHHLVEVIGEEKGQPF
DPHFRINNAVSNIICSITFGERFEYDDSQFQELLKLADEVICSEASMTSVLYNVFPLIFK
YLPGPHQTVFKNWEKLKSIVANMIDRHRKDWNPDEPRDFVDAFLTEMTKYPDKTTTSFNE
ENLIATTLDLFFAGTETTSTTLRWALLYITLNPEVQEKVHSEIDRVIGHGRLPSTDDQDA
MPYTNAVIHEVLRMGNIIPLNVPREVTADSTLAGFHLPKGKMILTNLTALHRDPKEWATP
DTFNPEHFLENGQFKKRDSFLPFSVGKRACPGEKLAKSELFIFFTALMQNFTFKAPTNEK
LSLKLRKGLSLYPVSYRICAVPR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccactgtgggctccctgttggctaaaatatggtcagcaatcaatttctggact
ttgttgctcactcttctcaccttcctgctcttggctgactacctcaaaaacaggcgcccc
aacaactaccctccagggccctggcgccttccatttgtgggtaacttgttccagtttgat
ttaaatatatcacatctgcatttgaggatccagcagtttgtgaagaaatatggaaaccta
attagccttgattttggcaacatctcagtagtggtcataactggactgcccttaatcaaa
gaagctctcatcaacaatgaacaaaactttttaaaacgccccattgtacctagcaggtac
cgtgtctttaaagataatggaattttttttgctaatgtccataaatggaaggagcaaaga
agatttgcactgacaatgctcaagaattttggattagggaagaagagcttagagcaatgc
atacaggaagaggcccaccatcttgtggaggtcataggagaagagaaaggacagccattt
gaccctcacttcaggatcaacaatgcagtttccaatatcatttgctccatcacctttggg
gagcgctttgagtatgatgacagtcagtttcaagagctgctgaagttagcagatgaggtc
atatgttctgaggcatcaatgacatcagtgctctacaatgtctttccactcatatttaaa
tatcttcctggaccacatcaaacagtttttaaaaactgggagaaactgaaatcgattgtt
gcaaatatgatagaccgtcacagaaaagactggaatcctgatgagccgagagacttcgtt
gatgctttcctgacagaaatgacaaagtacccagacaagactactacaagtttcaatgaa
gaaaatctcatcgctaccactctggacctcttctttgctggaacagagacaacatccaca
acattgcgctgggctctgctctacattacgctcaacccagaagtacaagaaaaagtacat
tctgagattgatagagtgattggccatgggaggctgccaagtacagatgaccaagatgcc
atgccctacaccaatgctgtcatccatgaggttctgaggatgggcaacatcatccccttg
aatgttcccagggaagtgacagctgatagcacattggctggattccacctgcctaagggc
aaaatgatcctgaccaatttgactgctctgcacagggaccccaaagagtgggccacccca
gacaccttcaatccagaacattttttggagaatggacagtttaagaagagagactctttt
ctgcctttctcagtgggaaagagagcgtgcccaggagaaaaactggccaagtccgagctg
ttcattttcttcactgctcttatgcaaaactttaccttcaaggccccaaccaatgagaag
ctgagcctgaagttgagaaagggcctctccctttacccagtcagctaccgcatctgtgct
gtacctagatag

DBGET integrated database retrieval system