KEGG   Rattus norvegicus (rat): 50592Help
Entry
50592             CDS       T01003                                 

Gene name
Gria1, GluA1, gluR-A
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 1
  KO
K05197  
glutamate receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Long-term depression
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    50592 (Gria1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    50592 (Gria1)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    50592 (Gria1)
   04728 Dopaminergic synapse
    50592 (Gria1)
   04720 Long-term potentiation
    50592 (Gria1)
   04730 Long-term depression
    50592 (Gria1)
   04723 Retrograde endocannabinoid signaling
    50592 (Gria1)
  Environmental adaptation
   04713 Circadian entrainment
    50592 (Gria1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    50592 (Gria1)
  Substance dependence
   05031 Amphetamine addiction
    50592 (Gria1)
   05033 Nicotine addiction
    50592 (Gria1)
Ion channels [BR:rno04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   50592 (Gria1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10
AA seq 907 aa AA seqDB search
MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGGGGSGENGRVVSQDFPKSMQSIPCMSHSSGM
PLGATGL
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacatctttgcctttttctgcaccggttttctaggtgcggttgtgggtgccaat
ttccccaacaatatccagataggggggttatttccaaaccaacaatcacaggaacatgcg
gcttttaggtttgctttgtcacaactcacggagccccccaagctgcttccccagatcgat
attgtgaacatcagcgacagctttgagatgacttaccgtttctgttcccagttctccaaa
ggagtctatgccatctttggattttatgaacgaaggactgtcaacatgctgacctccttc
tgtggggccctccatgtgtgcttcattactccaagttttcctgttgacacatccaatcaa
tttgtccttcagctacgcccggaactacaggaagctctcattagcattatcgaccattac
aagtggcaaacctttgtctacatttatgatgctgaccggggcctgtcagtcctgcagaga
gtcttggatacagccgcagagaagaactggcaggtaacggctgtcaacattctgacaacc
accgaggaaggataccggatgctctttcaggacctggagaagaaaaaggagaggctggtg
gtggttgactgtgaatcagaacgcctcaacgccatcctgggccagatcgtgaagctagaa
aagaatggcatcgggtaccactacatcctcgccaatctgggcttcatggacattgactta
aataagttcaaggagagcggagccaatgtgacaggtttccagctggtgaactacacagac
acgatcccagccagaatcatgcagcaatggaggacaagtgactcccgagaccataccagg
gtggactggaagaggccaaagtacacttctgctctcacctatgatggtgtcaaggtgatg
gctgaggccttccaaagcctgcggaggcagaggattgacatatcccgccgggggaatgct
ggggactgtctggctaacccagctgtgccctggggtcaagggatcgacatccagagagcc
ctgcagcaggtgcgcttcgaaggtttgacaggaaatgtgcagttcaacgagaaagggcgc
cggaccaattacaccctccacgtgatcgaaatgaaacatgatggaatccgaaagattggt
tactggaatgaagacgataaatttgtccccgcagccaccgacgctcaggctggaggggac
aactcaagcgtccagaataggacctacatcgtcactactatcctcgaagatccttacgtg
atgcttaaaaagaatgccaaccagtttgagggcaatgaccgctatgagggctactgtgtg
gagctggctgcagagatcgccaagcacgtgggctactcctaccgacttgagattgtcagc
gacggcaaatatggagcccgggatcccgacacaaaggcttggaatggcatggtgggagaa
ctggtctatggaagagcagacgtggctgtggctcccttgaccataaccttggtccgggag
gaagtcatcgacttctccaagccattcatgagtttgggaatctccattatgattaagaag
ccacagaagtccaagccaggtgtcttctcctttcttgaccctttggcctatgagatctgg
atgtgtatagtgtttgcctacattggagtgagcgtcgtcctcttcctggtcagccgtttc
agcccctacgaatggcacagcgaagagtttgaagagggacgagaccagacaaccagtgac
cagtcaaatgagtttggcatattcaacagcctgtggttctccctgggggccttcatgcag
caaggatgtgacatttcccccaggtccctgtccggacgcatcgtcggcggcgtctggtgg
ttcttcactttgatcatcatctcctcgtacacagccaacctggctgccttcctgactgtg
gagaggatggtgtctcccattgagagtgcagaggacctggcaaagcagacggaaattgct
tatgggacattggaagcaggctccactaaggagttcttcaggagatctaaaatcgctgtg
tttgagaagatgtggacatacatgaagtctgcagaaccatccgtgtttgttcggaccaca
gaggaaggcatgatcagagtgagaaaatctaaaggcaaatacgcctacctcctggagtcc
accatgaatgagtatattgagcaacgaaagccctgtgacaccatgaaagtgggaggtaac
ttggattccaaaggctatggcattgcgacacccaaggggtccgccctgagaaatccagta
aacctggcagtgttaaaactgaacgagcaggggcttttggacaaattgaaaaacaaatgg
tggtacgacaagggcgagtgcggcagcgggggaggtgactccaaggacaagaccagcgct
ttgagcctcagcaatgtggcaggcgtgttctacatcctgattggagggctgggactggcc
atgctggttgccttaatcgagttctgctacaaatcccgtagcgagtcgaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaatgaagccatacggacatcgaccctcccc
cggaacagtggggcaggagccagcggaggaggcggcagtggagagaatggccgggtggtc
agccaggacttccccaagtccatgcaatccattccctgcatgagtcacagttcagggatg
cccttgggagccacaggattgtaa

DBGET integrated database retrieval system