KEGG   Rattus norvegicus (rat): 50654Help
Entry
50654             CDS       T01003                                 

Gene name
Ctss
Definition
(RefSeq) cathepsin S (EC:3.4.22.27)
  KO
K01368  
cathepsin S [EC:3.4.22.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysosome
Phagosome
Apoptosis
Antigen processing and presentation
Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    50654 (Ctss)
   04142 Lysosome
    50654 (Ctss)
  Cell growth and death
   04210 Apoptosis
    50654 (Ctss)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    50654 (Ctss)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    50654 (Ctss)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.27  cathepsin S
     50654 (Ctss)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C1: papain family
   50654 (Ctss)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Papain family
   50654 (Ctss)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
2q34
AA seq 330 aa AA seqDB search
MAVLGAPGVLCDNGATAERPTLDHHWDLWKKTRMRRNTDQNEEDVRRLIWEKNLKFIMLH
NLEHSMGMHSYSVGMNHMGDMTPEEVIGYMGSLRIPRPWNRSGTLKSSSNQTLPDSVDWR
EKGCVTNVKYQGSCGSCWAFSAEGALEGQLKLKTGKLVSLSAQNLVDCSTEEKYGNKGCG
GGFMTEAFQYIIDTSIDSEASYPYKAMDEKCLYDPKNRAATCSRYIELPFGDEEALKEAV
ATKGPVSVGIDDASHSSFFLYQSGVYDDPSCTENMNHGVLVVGYGTLDGKDYWLVKNSWG
LHFGDQGYIRMARNNKNHCGIASYCSYPEI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggctgttttgggtgcccctggtgtgctctgtgacaatggagcaactgcagagagacct
accctggaccaccactgggatctctggaagaaaactcgcatgagaaggaatacagatcag
aatgaagaagacgtacgacgtctcatctgggaaaagaatctcaagtttataatgcttcac
aatctggaacattctatgggaatgcattcatacagtgtgggcatgaaccacatgggagac
atgacacctgaagaagtcataggttatatgggctctctgagaattcccaggccctggaat
agaagtggcactctcaagtcaagctctaatcagacattgcccgactctgtggactggcga
gaaaagggctgcgtcactaatgtgaaataccagggctcttgtggttcctgctgggctttc
agcgccgagggggcccttgaagggcagctgaagctgaaaacggggaagctggtgtctctc
agtgctcagaacctggtggattgctcaaccgaagaaaagtacgggaataaaggctgcggg
ggtggcttcatgaccgaagctttccagtacatcatcgatacgagcatcgactcagaagct
tcctatccctacaaagccatggatgaaaagtgtctctatgacccaaaaaatcgagctgcc
acgtgttcaaggtacattgagctccccttcggcgatgaagaagctctgaaagaagcagtg
gccactaaagggcctgtctctgtgggcatcgacgacgccagccattcctccttcttcctc
taccaaagtggtgtctatgatgacccctcctgtaccgagaatatgaatcatggtgttctc
gtggttggctatgggactcttgatgggaaagactactggcttgtgaaaaacagttggggc
cttcactttggtgatcaaggatatattcggatggcgagaaataacaaaaatcactgcggg
attgctagctattgctcttacccagaaatctaa

DBGET integrated database retrieval system