KEGG   Rattus norvegicus (rat): 50658Help
Entry
50658             CDS       T01003                                 

Gene name
Mapk9, SAPK
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04310  Wnt signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04530  Tight junction
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04926  Relaxin signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05132  Salmonella infection
rno05133  Pertussis
rno05142  Chagas disease (American trypanosomiasis)
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05164  Influenza A
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05168  Herpes simplex infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05231  Choline metabolism in cancer
rno05418  Fluid shear stress and atherosclerosis
Module
rno_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    50658 (Mapk9)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    50658 (Mapk9)
   04010 MAPK signaling pathway
    50658 (Mapk9)
   04012 ErbB signaling pathway
    50658 (Mapk9)
   04310 Wnt signaling pathway
    50658 (Mapk9)
   04668 TNF signaling pathway
    50658 (Mapk9)
   04068 FoxO signaling pathway
    50658 (Mapk9)
   04071 Sphingolipid signaling pathway
    50658 (Mapk9)
   04024 cAMP signaling pathway
    50658 (Mapk9)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    50658 (Mapk9)
   04137 Mitophagy - animal
    50658 (Mapk9)
  Cell growth and death
   04210 Apoptosis
    50658 (Mapk9)
   04215 Apoptosis - multiple species
    50658 (Mapk9)
   04217 Necroptosis
    50658 (Mapk9)
  Cellular community - eukaryotes
   04510 Focal adhesion
    50658 (Mapk9)
   04530 Tight junction
    50658 (Mapk9)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    50658 (Mapk9)
   04621 NOD-like receptor signaling pathway
    50658 (Mapk9)
   04622 RIG-I-like receptor signaling pathway
    50658 (Mapk9)
   04625 C-type lectin receptor signaling pathway
    50658 (Mapk9)
   04660 T cell receptor signaling pathway
    50658 (Mapk9)
   04658 Th1 and Th2 cell differentiation
    50658 (Mapk9)
   04659 Th17 cell differentiation
    50658 (Mapk9)
   04657 IL-17 signaling pathway
    50658 (Mapk9)
   04664 Fc epsilon RI signaling pathway
    50658 (Mapk9)
  Endocrine system
   04910 Insulin signaling pathway
    50658 (Mapk9)
   04920 Adipocytokine signaling pathway
    50658 (Mapk9)
   04912 GnRH signaling pathway
    50658 (Mapk9)
   04914 Progesterone-mediated oocyte maturation
    50658 (Mapk9)
   04917 Prolactin signaling pathway
    50658 (Mapk9)
   04926 Relaxin signaling pathway
    50658 (Mapk9)
  Nervous system
   04728 Dopaminergic synapse
    50658 (Mapk9)
   04723 Retrograde endocannabinoid signaling
    50658 (Mapk9)
   04722 Neurotrophin signaling pathway
    50658 (Mapk9)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    50658 (Mapk9)
  Development
   04380 Osteoclast differentiation
    50658 (Mapk9)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    50658 (Mapk9)
   05231 Choline metabolism in cancer
    50658 (Mapk9)
   05210 Colorectal cancer
    50658 (Mapk9)
   05212 Pancreatic cancer
    50658 (Mapk9)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    50658 (Mapk9)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    50658 (Mapk9)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    50658 (Mapk9)
   04931 Insulin resistance
    50658 (Mapk9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    50658 (Mapk9)
  Infectious diseases
   05132 Salmonella infection
    50658 (Mapk9)
   05133 Pertussis
    50658 (Mapk9)
   05152 Tuberculosis
    50658 (Mapk9)
   05164 Influenza A
    50658 (Mapk9)
   05161 Hepatitis B
    50658 (Mapk9)
   05160 Hepatitis C
    50658 (Mapk9)
   05168 Herpes simplex infection
    50658 (Mapk9)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    50658 (Mapk9)
   05169 Epstein-Barr virus infection
    50658 (Mapk9)
   05145 Toxoplasmosis
    50658 (Mapk9)
   05142 Chagas disease (American trypanosomiasis)
    50658 (Mapk9)
  Drug resistance
   01522 Endocrine resistance
    50658 (Mapk9)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     50658 (Mapk9)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   50658 (Mapk9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Kinase-like FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 50658
NCBI-ProteinID: NP_001257473
RGD: 628847
Ensembl: ENSRNOG00000002823
UniProt: P49186 Q6P727 D4A5V8
Position
10q21
AA seq 423 aa AA seqDB search
MSDSKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagtaaaagcgatggccagttttacagtgtgcaagtggcagactcaactttc
actgttctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaattgtt
tgtgctgcttttgatacagttcttggaataaatgttgctgtcaagaagttaagtcgtcct
tttcagaaccaaacgcatgcaaagagagcctaccgtgaacttgtcctcctaaagtgtgtc
aatcataaaaatataattagcttgttaaatgtgttcacaccacaaaaaacgctagaagaa
ttccaagatgtgtacttggttatggagttaatggacgctaacttatgtcaggttattcat
atggagctggaccatgaaagaatgtcatacctcctctaccagatgctttgtggcattaag
cacctgcattcagctggcataattcatagggatttgaagcctagcaacattgtagtaaaa
tcagactgtactctcaagatccttgactttggcctggcacggacagcctgtaccaacttt
atgatgactccctatgtggtaactcgctactatcgggctccagaagtcatcctgggcatg
ggctacaaggagaatgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc
cataaagtcctgttcccaggaagagactatattgatcaatggaataaagttattgaacag
ctaggaacaccatccgcagagttcatgaagaaacttcagccaactgtaaggaattatgtg
gaaaacagaccaaagtaccctggaatcaaatttgaagagctctttccagattggatattt
ccgtcagaatccgaacgagacaaaataaaaacaagtcaagccagagatctgttatcgaaa
atgttagtgattgatccggacaagcggatctctgtggacgaagccttgcgccacccgtat
attactgtttggtatgaccccgctgaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagaaagagagcatgcgattgaagagtggaaagaactaatttacaaagaagtg
atggactgggaagaaagaagcaagaatggggtgaaagaccagccttcagatgcagcagta
agcagcaaggctactccttctcagtcgtcatccatcaatgacatctcatccatgtccact
gagcacaccctggcctcagacacagacagcagtctcgatgcctcaaccggacccctggaa
ggctgccgatga

DBGET integrated database retrieval system