KEGG   Rattus norvegicus (rat): 50669Help
Entry
50669             CDS       T01003                                 

Gene name
Prf1, Cyta, RATCYTA
Definition
(RefSeq) perforin 1
  KO
K07818  
perforin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    50669 (Prf1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    50669 (Prf1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    50669 (Prf1)
   05330 Allograft rejection
    50669 (Prf1)
   05332 Graft-versus-host disease
    50669 (Prf1)
  Cardiovascular diseases
   05416 Viral myocarditis
    50669 (Prf1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    50669 (Prf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
20q11
AA seq 554 aa AA seqDB search
MAAYLFLLGLFLLLPRPVPAPCYTATRSECKQKHKFVPGVWAAGEGVDVTTLRRSSSFPV
NTGKFLRPDRTCTLCKNALMNDAIQRLPVAIAHWRPHGSHCQRNVATTKVSSTEGVAREA
AANINNDWRAGLDVNPKPEANVHVSVAGSHSKIANFAAEKAHQDQYNFNTDTVECRMYSF
RLAQKPPLHPDFRKALKNLPHNFNSSTEHAYRRLISSYGTHFITAVDLGGRVSVLTALRT
CQLTLDGLTADEVGDCLSVEAQVSIGAQASVSSEYKACEEKKKQHKIATSFHQTYRERHV
EVLGGPLDSSNDLLFGNQATPEHFSTWIASLPTRPDVVDYSLEPLHILLEDSDPKREALR
QAISHYVMSRARWRDCNRPCRAGQHKSSRDSCQCVCQDSKVTNQDCCPRQRGLAKLMVRN
FQAKGLWGDYITSTDAYLKVFFGGQEIRTGVVWNNNHPSWSDKMDFGNVLLSTGGPLRVQ
VWDADNGWDDDLLGTCDKSPKSGFHEVNCPLNHGSIKFIYQANCLPHLTGETCLEYAPQG
LLGDPPGNRSGAVW
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtacctgttcctcctgggccttttcctgctgctgccacgacctgtccctgct
ccctgctacactgccactcggtcagaatgcaagcagaagcacaaattcgtgcctggtgtg
tgggcggctggggaaggtgtggatgtgaccaccctccgccgctccagctccttcccagtg
aacacagggaagttcctgaggcctgaccgcacctgcaccctctgtaaaaacgccctgatg
aatgacgctatacagcgcctacccgtggcaatcgcccactggcggcctcacggctcacac
tgccagcgtaatgtggccacaaccaaggtcagctccacggagggtgtggcgcgggaggcg
gctgctaatatcaataacgactggcgtgcggggctggatgtgaaccctaaaccggaagca
aacgtgcatgtgtccgtggctggctcccattccaagatagccaattttgcagccgagaag
gcccatcaggaccaatacaactttaatactgacacagtggagtgtcgcatgtacagtttt
cgcctggcacaaaagcctccactccaccctgacttcagaaaggcactcaagaaccttccc
cacaactttaacagctccacagagcatgcttaccgtagactcatctcttcctatgggact
cattttattacggctgtggacctaggtggccgcgtctcggtcctcacggctctgcgtacc
tgtcagctgaccctggatgggctcacagctgatgaggtaggagactgcttgagcgtggaa
gcccaggtcagcatcggtgcccaagccagtgtctcaagcgaatacaaagcttgcgaggag
aagaagaaacaacacaaaatcgccacctctttccaccagacctaccgtgagcgtcatgtc
gaagtgctcggtggcccccttgactcctcgaatgacctgctcttcgggaaccaagctacc
cctgagcacttctctacctggatagcctcattgcccaccaggcctgatgtggtggactac
agcctggagcccctgcacatactactggaagactcggacccgaagcgagaggcactgaga
caggctatcagccattatgtgatgagcagggctcgctggcgagactgtaaccggccctgc
agggcaggccagcataagagtagtcgtgattcatgccagtgtgtgtgccaggattcgaag
gtcaccaaccaggactgctgcccacgccagaggggcttggccaagttgatggtaaggaat
ttccaggccaagggtctgtggggggactacatcacatctacggatgcttatctgaaggtc
ttctttggtggccaggagatcaggaccggtgtagtgtggaacaataaccatccctcgtgg
agtgacaagatggactttgggaatgtgctcctgtccacagggggacccctcagggtgcag
gtctgggatgctgacaatggctgggatgatgaccttcttggtacttgtgacaagtctccc
aagtctggtttccatgaggtgaattgtcccctgaaccacggcagtataaaattcatctac
caggccaattgcttgccccatctcactggagagacctgcctggagtatgccccccagggg
cttctaggagatccaccaggaaaccgcagtggggctgtgtggtaa

DBGET integrated database retrieval system