KEGG   Rattus norvegicus (rat): 50669Help
Entry
50669             CDS       T01003                                 

Gene name
Prf1, Cyta, RATCYTA
Definition
perforin 1 (pore forming protein)
Orthology
K07818  
perforin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    50669 (Prf1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    50669 (Prf1)
   05330 Allograft rejection
    50669 (Prf1)
   05332 Graft-versus-host disease
    50669 (Prf1)
  Cardiovascular diseases
   05416 Viral myocarditis
    50669 (Prf1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    50669 (Prf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
20q11
AA seq 554 aa AA seqDB search
MAAYLFLLGLFLLLPRPVPAPCYTATRSECKQKHKFVPGVWAAGEGVDVTTLRRSSSFPV
NTGKFLRPDRTCTLCKNALMNDAIQRLPVAIAHWRPHGSHCQRNVATTKVSSTEGVAREA
AANINNDWRAGLDVNPKPEANVHVSVAGSHSKIANFAAEKAHQDQYNFNTDTVECRMYSF
RLAQKPPLHPDFRKALKNLPHNFNSSTEHAYRRLISSYGTHFITAVDLGGRVSVLTALRT
CQLTLDGLTADEVGDCLSVEAQVSIGAQASVSSEYKACEEKKKQHKIATSFHQTYRERHV
EVLGGPLDSSNDLLFGNQATPEHFSTWIASLPTRPDVVDYSLEPLHILLEDSDPKREALR
QAISHYVMSRARWRDCNRPCRAGQHKSSRDSCQCVCQDSKVTNQDCCPRQRGLAKLMVRN
FQAKGLWGDYITSTDAYLKVFFGGQEIRTGVVWNNNHPSWSDKMDFGNVLLSTGGPLRVQ
VWDADNGWDDDLLGTCDKSPKSGFHEVNCPLNHGSIKFIYQANCLPHLTGETCLEYAPQG
LLGDPPGNRSGAVW
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtacctgttcctcctgggccttttcctgctgctgccacgacctgtccctgct
ccctgctacactgccactcggtcagaatgcaagcagaagcacaaattcgtgcctggtgtg
tgggcggctggggaaggtgtggatgtgaccaccctccgccgctccagctccttcccagtg
aacacagggaagttcctgaggcctgaccgcacctgcaccctctgtaaaaacgccctgatg
aatgacgctatacagcgcctacccgtggcaatcgcccactggcggcctcacggctcacac
tgccagcgtaatgtggccacaaccaaggtcagctccacggagggtgtggcgcgggaggcg
gctgctaatatcaataacgactggcgtgcggggctggatgtgaaccctaaaccggaagca
aacgtgcatgtgtccgtggctggctcccattccaagatagccaattttgcagccgagaag
gcccatcaggaccaatacaactttaatactgacacagtggagtgtcgcatgtacagtttt
cgcctggcacaaaagcctccactccaccctgacttcagaaaggcactcaagaaccttccc
cacaactttaacagctccacagagcatgcttaccgtagactcatctcttcctatgggact
cattttattacggctgtggacctaggtggccgcgtctcggtcctcacggctctgcgtacc
tgtcagctgaccctggatgggctcacagctgatgaggtaggagactgcttgagcgtggaa
gcccaggtcagcatcggtgcccaagccagtgtctcaagcgaatacaaagcttgcgaggag
aagaagaaacaacacaaaatcgccacctctttccaccagacctaccgtgagcgtcatgtc
gaagtgctcggtggcccccttgactcctcgaatgacctgctcttcgggaaccaagctacc
cctgagcacttctctacctggatagcctcattgcccaccaggcctgatgtggtggactac
agcctggagcccctgcacatactactggaagactcggacccgaagcgagaggcactgaga
caggctatcagccattatgtgatgagcagggctcgctggcgagactgtaaccggccctgc
agggcaggccagcataagagtagtcgtgattcatgccagtgtgtgtgccaggattcgaag
gtcaccaaccaggactgctgcccacgccagaggggcttggccaagttgatggtaaggaat
ttccaggccaagggtctgtggggggactacatcacatctacggatgcttatctgaaggtc
ttctttggtggccaggagatcaggaccggtgtagtgtggaacaataaccatccctcgtgg
agtgacaagatggactttgggaatgtgctcctgtccacagggggacccctcagggtgcag
gtctgggatgctgacaatggctgggatgatgaccttcttggtacttgtgacaagtctccc
aagtctggtttccatgaggtgaattgtcccctgaaccacggcagtataaaattcatctac
caggccaattgcttgccccatctcactggagagacctgcctggagtatgccccccagggg
cttctaggagatccaccaggaaaccgcagtggggctgtgtggtaa

DBGET integrated database retrieval system