KEGG   Rattus norvegicus (rat): 50672Help
Entry
50672             CDS       T01003                                 

Gene name
Ednrb, Ednra, Etb
Definition
(RefSeq) endothelin receptor type B
  KO
K04198  
endothelin receptor type B
Organism
rno  Rattus norvegicus (rat)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Melanogenesis
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    50672 (Ednrb)
   04022 cGMP - PKG signaling pathway
    50672 (Ednrb)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    50672 (Ednrb)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    50672 (Ednrb)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    50672 (Ednrb)
G protein-coupled receptors [BR:rno04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Endothelin
    50672 (Ednrb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
15q21-q22
AA seq 442 aa AA seqDB search
MQSSASRCGRALVALLLACGLLGVWGEKRGFPPAQATPSLLGTKEVMTPPTKTSWTRGSN
SSLMRSSAPAEVTKGGRVAGVPPRSFPPPCQRKIEINKTFKYINTIVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINAYKLLAGDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DVITSDYKGKPLRVCMLNPFQKTAFMQFYKTAKDWWLFSFYFCLPLAITAIFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYDQSNPQRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQTFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgtccgcaagccggtgcggacgcgccttggtggcgctgctgctggcctgtggc
ttgttgggggtatggggagagaaaagaggattcccacctgcccaggccacaccatctctt
ctcgggactaaagaagttatgacgccacccactaagacctcctggactagaggttccaac
tccagtctgatgcgttcctccgcacctgcggaggtgaccaaaggagggagggtggctgga
gtcccgccaagatccttccctcctccgtgccaacgaaaaattgagatcaacaagactttt
aaatacatcaacacgattgtatcatgcctcgtgttcgtgctaggcatcatcgggaactcc
acactgctaagaatcatctacaagaacaagtgcatgagaaatggtcccaatatcttgatc
gccagcctggctctgggagatctgctacacatcatcatcgacattcccattaatgcctac
aagctgctggcaggggactggccatttggagctgagatgtgcaagctggtgcccttcata
cagaaggcttctgtggggatcacagtgttgagtctatgtgctctaagtattgacagatat
cgagctgttgcttcttggagtcgaattaaaggaattggggttccaaaatggacagcagta
gaaattgttttaatttgggtggtctctgtggttctggctgtccctgaagccataggtttt
gatgtgattacgtcggactacaaaggaaagcccctaagggtctgcatgcttaatcccttt
cagaaaacagccttcatgcagttttacaagacagccaaagactggtggctgttcagtttc
tacttctgcttgccgctagccatcactgcgatcttttacaccctaatgacctgtgagatg
ctcagaaagaaaagtggtatgcagattgccttgaatgaccacttaaagcagagacgagaa
gtggccaagacagtattctgcctggtcctcgtgtttgccctctgttggcttccccttcac
ctcagcaggattctgaagctcaccctttatgaccagagcaatcctcagaggtgtgaactt
ctgagttttttgctggttttggactacattggtatcaacatggcttctttgaattcctgc
attaatccaatcgctctgtatttggtgagcaagagattcaaaaactgctttaagtcgtgt
ttgtgctgctggtgccaaacgtttgaggaaaaacagtccttagaggagaagcaatcctgc
ttgaagttcaaagctaacgatcacggatacgacaacttccgctccagcaataaatacagc
tcatcttga

DBGET integrated database retrieval system