KEGG   Rattus norvegicus (rat): 54241Help
Entry
54241             CDS       T01003                                 

Gene name
Cltc
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:rno04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:rno04142]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:rno04961]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:rno04721]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:rno05016]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:rno05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q26
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQIWVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNSLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYKAIQFYLEFKPLLLNDLLMVLSPRLAHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgccaattcgctttcaggagcatctccagctccagaacctgggtatc
aacccagcaaacattggcttcagtaccctgactatggagtcagacaaattcatctgcatt
agagaaaaagtgggagagcaggctcaggtggtgatcattgacatgaatgatccaagtaat
ccgattcgaagaccaatctcagcagacagtgccatcatgaatcctgccagcaaagtgatt
gcactgaaagctggaaaaactctacagatatttaacattgaaatgaaaagtaaaatgaag
gcccacaccatgaccgatgatgtcaccttctggaaatggatctctctgaatacggttgct
cttgttacggataatgcagtttatcactggagcatggagggggagtctcagccagtgaag
atgtttgatcgtcattccagcctcgcagggtgccagatcatcaattaccgtacagatgct
aagcagaagtggttgctcctgactggcatatctgcacagcaaaatcgcgtggttggagct
atgcagctgtattctgtagacaggaaagtctctcagcccattgaagggcatgcggcgagt
tttgcacaatttaagatggaaggaaacgcagaagaatcgacgttattttgttttgctgtg
cggggtcaggcaggggggaagttacatatcattgaagttggtacaccacccacaggaaac
caaccctttccaaagaaggcagtggatgtcttctttcctccagaagcacaaaatgatttt
cctgttgcaatgcagatcagtgaaaagcatgacgtggtgttcctgattaccaagtatggt
tatattcacctctatgaccttgagactggcacgtgcatctacatgaacagaatcagtgga
gaaaccatctttgttactgctcctcatgaagccacagctggaataataggagtcaacaga
aagggacaagtcctatcagtttgtgtggaagaagagaacataattccttacatcaccaat
gtcctacaaaatcctgatttggctctgagaatggctgtgcggaacaacctagctggtgca
gaagagctcttcgcccggaaatttaatgctctcttcgcccagggaaactactcagaggct
gcaaaggtggctgctaatgcaccgaagggaatccttcgtactccagataccatccgtcga
ttccagagtgtcccagctcagccaggtcaaacttcacctctgcttcagtattttggaatc
cttttggaccaaggccagctgaacaaatacgagtccttagagttatgtagacctgtcctt
cagcaagggcggaaacaacttttggagaaatggctgaaagaagataagctggaatgttct
gaagaactgggtgatctcgtaaaatctgtggacccaacgttagcactgagtgtatacctc
agggccaatgtccctaataaagtcatccagtgctttgcagagacaggtcaagtccagaag
attgttttatatgctaaaaaagttggctatactccagactggatctttctcctgagaaat
gtcatgcggatcagtccagatcaaggacagcagtttgcccaaatgttagttcaggacgaa
gaacctcttgctgatatcacacagattgtggatgtctttatggaatacaatctaatccaa
caatgtactgccttcttacttgatgctttgaagaataatcgcccttctgaaggtcctttg
cagacgcgattgcttgagatgaaccttatgcacgcacctcaagttgcagatgccattcta
gggaatcagatgttcacccactatgaccgggctcacatcgcccagctgtgtgagaaggcg
ggcctactgcagcgtgcattagaacatttcaccgacttatatgatataaaacgagcagtc
gttcatacccatcttctcaaccccgagtggttagtgaattactttgggtccttatcagtt
gaagattccctagaatgtctcagagccatgctgtctgctaatattcgtcaaaatctacag
atctgggttcaggtcgcttctaaatatcatgaacagctgtcaactcagtccctgattgaa
ctcttcgagtcattcaagagttttgaaggcctcttttattttctggggtccattgttaac
ttcagtcaagacccagatgtgcactttaaatatattcaggcggcttgcaagactggacaa
atcaaagaggtggaaagaatctgcagagagagcaactgctatgatccagagcgcgtcaag
aatttcctcaaggaggcgaaactcacagatcagttgccactcatcatcgtctgtgaccgc
tttgacttcgtccatgacctggtgctgtatttatacagaaacagtcttcagaagtacata
gagatatatgtccagaaagtaaatccaagtcgacttcctgtggttattggaggattgctg
gatgttgactgctctgaagatgtcattaaaaatttgattcttgttgtgagaggtcaattc
tctactgatgagcttgttgctgaagttgagaaaagaaacagattgaagctgcttcttcct
tggcttgaggctagaattcatgagggctgtgaggagcctgctacacacaatgcgttagcc
aaaatatacatcgacagcaataacaacccagagagattccttcgtgaaaacccctactat
gacagtcgtgtcgtgggaaagtactgtgagaagagagacccacatctggcctgtgttgct
tatgaacgtggccagtgtgatctggaactaatcaacgtttgcaatgagaattccctcttc
aaaagtctttctcgctacctggtccgtcgaaaggatccagagttgtggggtagtgtgcta
ctggaaagcaatccatacagaagaccattaattgaccaggtcgtacagacagccttgtct
gaaactcaggacccagaagaagtgtcagtaactgtcaaggcttttatgacagcagatctt
cctaatgaactcattgagctgctggagaaaattgtccttgataactctgtattcagtgaa
cacaggaatctgcaaaacctcctcatcctcactgcaattaaggctgaccgaacccgagtt
atggagtatattaaccgcctggacaattatgatgcgccagatattgccaacattgccatc
agcaatgagctcttcgaagaagcatttgctattttccggaagtttgatgtcaatacttca
gcagtgcaggtgttaattgaacatattggaaacctggatcgtgcatatgagtttgctgaa
cgctgcaatgagcctgctgtttggagtcaactcgcaaaagctcagttgcagaaagggatg
gtgaaggaagccattgattcttacatcaaagcagatgatccttcgtcttacatggaagtt
gttcaggccgccaatactagtggaaactgggaagaattggtgaagtatttgcagatggca
cgcaagaaggcccgagagtcctacgtggagacagaattgatatttgcactggctaaaaca
aaccgtcttgcagaattagaagagttcatcaatgggccaaataatgctcatattcagcaa
gttggtgaccgttgttatgatgagaaaatgtatgatgctgctaagttgttgtacaataat
gtttctaactttggacgtttggcgtctaccctagttcaccttggcgagtatcaggcagca
gttgatggtgctagaaaagctaatagtactcgaacatggaaagaggtctgctttgcctgt
gtagatgggaaagagtttcgccttgctcagatgtgtggactccatattgttgtgcatgca
gatgaattagaggagcttatcaactactatcaggatcgtggatattttgaagaactcatc
accatgttggaggcagccttgggactagagcgagctcacatgggaatgttcacagagcta
gcaattttgtattctaaattcaagccacagaaaatgagggaacacctagagttgttttgg
tcaagagtgaatattcctaaggtgctgagagccgcagagcaagcccatctttgggcagag
ctggtgtttctgtatgacaagtatgaagagtatgataatgccatcatcactatgatgaat
caccccaccgacgcatggaaggaagggcagttcaaagacatcatcaccaaggtggctaat
gtggaactgtactacaaagcaatccagttctacttagaattcaagcccttgttgttaaat
gacttgctcatggtgctgtctccacggttggctcatactcgtgcagtcaattatttcagc
aaggttaaacagctaccactggtgaaaccatatttacgctcagttcagaaccacaacaac
aagtccgtgaacgaatccctgaacaacctctttatcacagaggaggattaccaggctctg
cgaacatcaatagatgcttatgacaactttgacaacatctcacttgctcaacgtttggaa
aaacatgaactcattgaattcagaagaattgctgcttatctcttcaaaggaaacaatcgc
tggaaacagagtgtggagctgtgcaagaaagacagcctttacaaggatgcaatgcagtat
gcctctgaatcgaaagacacagaattggctgaagaactcctgcagtggtttctgcaggaa
gagaagagagaatgctttggagcttgtctcttcacctgctacgatcttttaaggccagat
gttgtcctggaaactgcatggagacataatatcatggattttgccatgccctatttcatc
caggtcatgaaggagtatttgaccaaggtggataaattagatgcttcggagtcactgaga
aaagaagaagaacaagctacagagacacagcccattgtttatggtcagccccagctgatg
ctaacagccggacccagtgtggcagtccctccccaggcaccttttggttatggttatact
gcaccaccatatgggcagccacagcctggctttgggtacagcatgtga

DBGET integrated database retrieval system