KEGG   Rattus norvegicus (rat): 54246Help
Entry
54246             CDS       T01003                                 

Gene name
Cyp2f4, CYP4502F4, Cyp2f1, Cyp2f2
Definition
cytochrome P450, family 2, subfamily f, polypeptide 4
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54246 (Cyp2f4)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     54246 (Cyp2f4)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   54246 (Cyp2f4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q21
AA seq 491 aa AA seqDB search
MDGVSTAILLLLLAVISLSLTFTSWGKGQLPPGPKPLPILGNLLQLRSQDLLTSLTKLSK
DYGSVFTVYLGPRRVIVLSGYQTVKEALVDKGEEFSGRGSYPIFFNFTKGNGIAFSDGER
WKILRRFSVQILRNFGMGKRSIEERILEEGSFLLDVLRKTEGKPFDPVFILSRSVSNIIC
SVIFGSRFDYDDERLLTIIHFINDNFQIMSSPWGEMYNIFPSLLDWVPGPHRRVFRNFGG
MKDLIARSVREHQDSLDPNSPRDFIDCFLTKMVQEKQDPLSHFNMDTLLMTTHNLLFGGT
ETVGTTLRHAFLILMKYPKVQARVQEEIDCVVGRSRMPTLEDRASMPYTDAVIHEVQRFA
DVIPMNLPHRVIRDTPFRGFLIPKGTDVITLLNTVHYDSDQFKTPQEFNPEHFLDANQSF
KKSPAFMPFSAGRRLCLGEPLARMELFIYLTSILQNFTLHPLVEPEDIDLTPLSSGLGNL
PRPFQLCMRIR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgtgagcacagccatcttgcttctcctcctggctgtcatctctctgtccctg
accttcacctcatggggcaagggccagctccctccaggacccaagcctctcccaatccta
ggaaacctgctgcagcttcgctcccaagacttgctgacctcactcaccaagcttagcaag
gactatgggtcagtgttcacggtgtacctggggcccaggcgtgtgattgtcctcagcgga
tatcaaactgtgaaggaggctcttgtggacaaaggggaggagttcagtggccgaggctca
taccccatctttttcaacttcaccaagggcaacggcatcgccttctccgatggagaacgc
tggaagatcctccgaaggttctctgtccaaatcctgaggaactttggcatgggaaaaaga
agcatcgaggagcggatcctggaagaaggcagcttcctgctggacgtgctgcggaaaacg
gaaggcaagccctttgaccccgtgtttatcctgagccgctcggtctccaacattatttgc
tctgtcatcttcggcagtcgtttcgattatgacgatgaacggctgctcaccattatccac
tttatcaatgacaacttccagattatgagcagcccctggggcgagatgtacaacatcttc
ccgagtctcctggactgggtgcctgggccgcacagacgcgtgttccggaactttgggggc
atgaaagatctcatcgcccgcagcgtccgcgagcaccaggactccctggaccccaactct
ccccgggacttcatcgactgcttcctcacaaaaatggtacaggagaagcaagacccactg
agccacttcaatatggacaccctnctgatgaccacacacaacctgctctttggtggaacg
gagactgtgggcaccactttacgccatgccttcctcattcttatgaagtaccccaaagtg
caagcccgtgtgcaggaagagattgattgtgtggtgggacgttcgcggatgcccacgctg
gaggaccgtgcatccatgccttacacagacgcggtgatccacgaagtgcagcgctttgca
gacgtcatccccatgaacctgccccaccgcgtcattcgggacacacctttcaggggcttc
ctgatacccaagggcacagatgtcatcacgctccttaacaccgtgcactatgactccgac
caattcaagacccctcaggagttcaatcctgagcattttctggatgccaatcaatccttc
aagaagagccccgccttcatgccattttcggcgggacgccgactgtgtctgggagagcca
ctggcacgcatggagctgttcatatacctcacctccattctccagaacttcacgttgcat
ccgctggtggagcctgaggacatcgacctgaccccgctcagctcagggctgggcaatttg
ccaaggcctttccagttgtgtatgcgcattcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system