KEGG   Rattus norvegicus (rat): 54268Help
Entry
54268             CDS       T01003                                 

Gene name
Mapk4
Definition
mitogen-activated protein kinase 4 (EC:2.7.11.24)
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     54268 (Mapk4)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   54268 (Mapk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
18q12.2
AA seq 583 aa AA seqDB search
MAEKGDCIASVYGYDLGGRFTDFQPLGFGVNGLVLSATDSRACRKVAVKKIVLSDARSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGSDLQGELFKFSVAYIVQEYMETDLACLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIADQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGKMLFAGAHELEQMQL
ILDTIPVVREEDKEELLRVMPSFVSSTWEVKRPLRKLLPDVNREAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDLVLMAASQSQLSNWDRYPVSLSSD
LEWRPDRCQDASEVQRDPRAGSTPLAEDVQVDPRKDSQSSSERFLEQSHSSMERAFEADY
GRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAASAPPRAAVAADPVSRED
EPASLFLEIAQWVKSTQGGPERASPPPDAPEPRLSASPPGHPTPIDGGASPQFDLDVFIS
RALKLCTKPEDLPENKLGDLNGACISEHPGDLVQTEAFSKERW
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaaggtgactgcatcgccagtgtctacgggtacgaccttggtgggcgcttc
actgacttccaacccctcggcttcggggtcaacgggctggtgctgtcggctacggacagc
agggcttgccggaaggtagccgtgaagaagattgtgctgagtgacgcacgaagcatgaag
cacgcgctccgagagatcaaaatcatccggcgcctggaccacgacaacatcgtcaaagtg
tacgaggtactgggacccaagggtagcgatctgcagggcgagctctttaagttcagcgtg
gcttatattgtccaagagtacatggagactgacctggcatgcctgctagagcagggcacg
ctgaccgaggagcacgctaagctattcatgtaccagctgctgcgtgggctcaagtacatc
cactctgccaacgtgttgcacagggacctgaagcccgccaacattttcatcagcacggag
gacctcgtgctgaagatcggggatttcgggctggccagaatcgcggaccagcattactcc
cacaagggttatctgtcggaagggttggtgacaaagtggtaccgctctccacgactgctc
ctgtccccgaacaactacacgaaagccatcgatatgtgggcagctggctgcatcctagcg
gagatgctcacggggaaaatgctctttgctggggctcacgagcttgagcagatgcagctc
atcctagacaccatccctgtagtgcgggaggaagacaaggaggagctgctcagggtgatg
ccgtcctttgtcagcagcacttgggaggtgaagaggccactgcgtaagctactcccggat
gtcaaccgtgaagccattgactttctggagaagatcctgacctttaaccccatggaccgc
ctaacagctgagatggggctacagcatccttacatgagcccgtattcgtgccccgaggat
gagcccacctcacaacaccccttccgcattgaagacgagatcgacgacctcgtactgatg
gctgccagtcagagccagctctccaactgggacaggtatcccgtgagcctgtcgtcagat
ctggaatggcggcctgaccgctgtcaggacgcgagcgaggtgcagcgcgacccacgtgct
ggctctactccgctggcggaggatgttcaggtggacccacgcaaggactcacagagcagc
tccgagcgcttcctggagcagtcgcactcgtccatggagcgcgcctttgaggccgactat
ggacggtcctgcgactacaaagtggggtctccgtcctacctggacaagctgctgtggcgc
gacaacaagccccaccactactcggaacccaagctcatcctggacctgtcgcactggaag
caggcggccagcgcaccccccagggctgcagtagcagcagacccagtgtcacgtgaggat
gagccagcaagcctctttctggagatcgcgcagtgggtcaagagcacacaaggtggccct
gagcgtgccagtcctccccctgatgccccagagccccgtctctctgcttcacccccggga
cacccaacacccattgatgggggtgccagtccccaattcgacttagatgtgttcatctcg
cgtgccctaaagctctgcaccaaacctgaggacctaccggaaaacaaactgggcgacctg
aatggtgcgtgcatctccgagcaccccggcgacctcgtgcaaacagaggccttctccaaa
gaaaggtggtga

DBGET integrated database retrieval system