KEGG   Rattus norvegicus (rat): 54282Help
Entry
54282             CDS       T01003                                 

Gene name
Padi1, Pdi1
Definition
(RefSeq) peptidyl arginine deiminase 1
  KO
K01481  protein-arginine deiminase [EC:3.5.3.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     54282 (Padi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAD PAD_M PAD_N
Motif
Other DBs
NCBI-GeneID: 54282
NCBI-ProteinID: NP_062205
RGD: 3287
Ensembl: ENSRNOG00000007067
UniProt: O88806
Position
5q36
AA seq 662 aa AA seqDB search
MASQRAVQLSLRKPAHAVCVIGVGTLVDVYSDVPKGAKTFEVSGSSEVKIYMVYDPSRVA
EPAGPAHWPLDANVDVVVVADTVSKNLHDLKVKVSYFKSQDTAALAHSLLYLTAVDVSLD
VDTGRTGKVKKGSGDKKNWRWGSGGSGAILLVNCDRDVHGSREDLHDSHLRSLEDLQDMS
PMVLSCDGPDDLFKSHKPVLKASLPDSRRLGVFCARGGTSLSNYKQVLGPRHNSYEVERH
PGERDIQFYVEGLAFPDASFSGLLSLSVSLVDTRPLSEVLVFTDSVTFRVAPWIMTPNTQ
PPLELYVCSVTDMHGSNDKFLEDMSHLATKANCKLVVCPRLENRNDRWIQDEMEFGYIDA
PHKSFPVVFDSPRNRGLRDFALKKILGPDFGYVTREIQFAGASGLDSFGNLDVSPPVRVG
NTEYPLGRILIGGNFPKSSGRRMARVVRDFLHAQQVQAPVELYSDWLSVGHVDEFLSFVP
TSDQKGFRLLLASPSACLQLFQEKKEEGYGEAKQFDGLKHKTKRSINDILADRHLRRDSA
HVQKCIDWNREVLKQELGLSESDIVDIPQLFFLKGAYAEAFFPDMVNMVVLGKYLGIPKP
FGPIINGRCCLEEKVRSLLEPLGLRCVFIDDFLFYHQLLGEIHCGTNVRRKPFAFRWWNS
VP
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccagcgagctgtgcagctgtctctgagaaagcctgctcatgccgtgtgtgtg
ataggtgtggggacactggtggatgtgtacagtgatgtgcccaaaggcgccaagaccttt
gaggtgtccgggagctctgaggtgaagatctacatggtctacgatccctcaagagtggca
gagcccgcaggcccggcccactggcccctggatgccaatgtggatgtggtggtggtggcg
gacacagtcagtaagaacttacacgacctcaaggtaaaggtatcatacttcaagtcccag
gacactgccgccctggcccacagccttctctacctaaccgctgttgatgtgtcccttgat
gtcgacacaggccgcacaggcaaggtgaagaaaggctctggtgacaagaaaaactggcgc
tggggctccgggggctccggggctatcctgttggtgaactgtgacagagatgtgcatggg
tccagagaggacctgcatgatagccatttgaggtcactggaggacctgcaggacatgtcc
ccaatggtgttgagctgtgacggccctgatgatctttttaagagccacaagccggtcttg
aaggcatctttgccggattccagaagactgggggtcttttgtgcccggggtgggacctcc
ctctccaactacaaacaggtgctggggccccgtcataactcctatgaggtggaaaggcat
cctggggagagggacattcagttctacgtggaaggactcgccttccctgatgccagtttc
tcagggctgctgtctctcagtgtcagcctggtagacacacggcccctctccgaggtgttg
gtcttcacggacagcgtgaccttccgagtggccccctggatcatgacccccaacacccag
ccgcccctggaactgtacgtgtgcagcgtgacagatatgcatggcagcaacgacaagttc
ttggaggacatgtcccacctggccacgaaggccaactgcaaactagtggtctgtccccgg
ctagagaatcgcaatgatcgatggatccaggatgagatggagtttggctacattgatgcc
cctcacaaatcgttccctgtggtctttgattccccccgaaacagaggcttgagggacttc
gcccttaagaagatcctgggtcctgactttggatatgtgacccgggagatccagttcgca
ggtgcctctggcctggattccttcggcaacctggatgtgagcccgccagtgagggtgggc
aacacagagtaccccctcggcagaatcctcatcggtggcaacttccctaagtccagcggg
cggcggatggccagggtggtgcgtgacttcctgcatgcccagcaggtgcaggctccggtg
gaactctactctgactggctctccgtgggccacgtggatgagtttctgagcttcgtgccc
acctctgaccaaaagggcttccggttactcctggccagccccagcgcctgcctccagctg
ttccaggagaagaaggaggagggctacggggaggccaagcagtttgatggcctcaagcat
aagacaaagagaagcatcaatgacatcttagctgacaggcacctcaggagggacagtgca
catgtgcagaaatgcatcgactggaaccgtgaggtgctaaaacaggagctgggcctctcc
gagagcgacatcgtggatattccacagctcttcttcctgaagggagcctacgctgaagcc
ttctttcctgacatggtcaatatggtggtcctcggcaagtacctgggcatccccaagccc
ttcgggcccatcatcaatggccgctgctgcctggaagagaaggtgcgctccctgctggag
ccgctgggtctacgctgcgtctttatcgacgactttctcttttaccaccaactgcttgga
gagatccattgtggcactaatgtgcggaggaaaccttttgcctttaggtggtggaactcc
gtgccctga

DBGET integrated database retrieval system