KEGG   Rattus norvegicus (rat): 54286Help
Entry
54286             CDS       T01003                                 

Gene name
Prkg1, Pkgi, cGk1
Definition
protein kinase, cGMP-dependent, type 1
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    54286 (Prkg1)
 Cellular Processes
  Cell communication
   04540 Gap junction
    54286 (Prkg1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    54286 (Prkg1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    54286 (Prkg1)
  Digestive system
   04970 Salivary secretion
    54286 (Prkg1)
  Nervous system
   04730 Long-term depression
    54286 (Prkg1)
  Sensory system
   04740 Olfactory transduction
    54286 (Prkg1)
  Environmental adaptation
   04713 Circadian entrainment
    54286 (Prkg1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     54286 (Prkg1)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   54286 (Prkg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
1q52
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactggaggaagactttgcgaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcggctgtcagagaaagaggaagaaatccaggagctgaagaggaaactc
cacaaatgccagtcggtgctgcccgtgccctccacccacattggcccgcggaccacccgg
gcgcagggcatctccgcggagccgcagacctacaggtccttccacgacctgcgccaggcg
ttccggaagttcactaaatccgagaggtcgaaggatctcataaaggaggctatccttgac
aatgacttcatgaagaacttggagctgtcacagatccaggagattgtggattgtatgtac
cccgtggaatatgggaaggacagctgcatcatcaaggaaggcgatgtggggtcactggtg
tatgtcatggaagatgggaaggtcgaagtcacaaaagaaggtgtgaagttgtgcaccatg
ggtcccgggaaagtgttcggggagctggctattctttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtgaaactctgggccattgatcgacaatgttttcaaacaata
atgatgagaacaggactcatcaagcacaccgagtacatggagtttttaaaaagtgttcca
acattccagagccttcctgatgaaatcctcagcaagctggctgatgtcctcgaagagact
cactatgaaaatggagaatatatcataaggcagggtgcaagaggagacaccttcttcatc
atcagcaaagggaaggtaaacgttacccgagaagactcaccaagtgaagacccagtcttt
cttagaactttagggaagggagattggtttggagagaaagccttgcagggggaggatgta
agaacagcgaacgtcattgctgcagaggctgtcacctgcctcgtgattgacagagactct
ttcaagcatttaattggaggactggatgatgtctctaacaaagcatatgaggatgcagaa
gcgaaagcaaaatatgaagccgaagctgccttcttcgccaacctgaagctgtctgacttc
aacatcattgacacccttggagtgggaggtttcggacgagtggagctggtccagttgaag
agtgaagaatctaaaacatttgcgatgaagatcctcaagaaacgacacattgtggacacg
agacagcaggagcacatccgctcagagaagcagatcatgcagggggctcattccgatttc
atcgtgaggctataccggacatttaaagacagcaaatacttgtatatgttgatggaagct
tgcctaggtggagaactctggactattctcagggataggggttcatttgaagactcgaca
accagattttacacagcatgtgtggtagaagcgtttgcctatctgcattccaaaggaatc
atttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactg
gttgactttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
accccagaatacgtggccccagagatcatcctgaacaaaggccatgacatttctgctgac
tactggtcactagggattctgatgtatgagcttctgactggcagcccacctttctcaggc
ccagatcctatgaaaacctacaacatcatactgcgggggattgacatgatagaatttcca
aagaagattgcaaaaaatgctgctaatttaattaaaaaactatgcagggacaacccatca
gaaaggttaggaaatttgaaaaacggagtcaaagacattcaaaaacacaagtggtttgag
ggctttaactgggaaggcttaagaaaaggcaccttgactcctcccataattccgagcgtt
gcgtcgcccacggacacaagcaattttgacagtttccctgaggacagcgacgagccaccg
cctgatgacaactcaggctgggacatagacttctaa

DBGET integrated database retrieval system