KEGG   Rattus norvegicus (rat): 54300Help
Entry
54300             CDS       T01003                                 

Gene name
Slc12a3, NCC, TSC
Definition
(RefSeq) solute carrier family 12 member 3
  KO
K14426  
solute carrier family 12 (sodium/chloride transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Brite
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   54300 (Slc12a3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   54300 (Slc12a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19p14-p12
AA seq 1002 aa AA seqDB search
MAELPVTEMPGDALCSGRFTISTLLGGDEPPPAACDNSQPSHLTHGSTLYLRTFGYNTID
VVPAYEHYANSALPGEPRKVRPTLADLHSFLKQEGSHLHALAFDGRPGHELTDGLVEDET
GANSEKSPGEPVRFGWVKGVMIRCMLNIWGVILYLRLPWITAQAGIVLTWLIILLSVMVT
SITGLSISAISTNGKVKSGGTYFLISRSLGPELGGSIGLIFAFANAVGVAMHTVGFAETV
RDLLQENGTPIVDPINDIRIIGVVTVTVLLAISLAGMEWESKAQVLFFLVIMVSFANYLV
GTLIPASKDKASKGFYSYHGDIFVQNLVPDWRGIDGSFFGMFSIFFPSATGILAGANISG
DLKDPAVAIPKGTLMAIFWTTISYLAISATIGSCVVRDASGDVNDTVTPGPGLCEGLACG
YGWNFTECSQQHSCRYGLINYYQTMSMVSAFAPLITAGIFGATLSSALACLVSAAKVFQC
LCEDQLYPLIGFFGKGYGKNKEPVRGYLLAYAIAVAFIIIAELNTIAPIISNFFLCSYAL
INFSCFHASITNSPGWRPSFRYYSKWAALFGAVISVVIMFLLTWWAALIAIGVVLFLLLY
VIYKKPEVNWGSSVQAGSYNLALSYSVGLNEVEDHIKNYRPQCLVLTGPPNFRPALVDFV
STFTQNLSLMICGHVLIAPGKQRVPELRLIASGHTKWLNKRKIKAFYSDVIAEDLRSGVQ
ILMQASGLGRMKPNILVVGFKKNWQSAHPATLEDYIGILHDAFDFNYGVCIMRMREGLNV
SEALQTHTAPEALVQEEQTSTIFQSEQGKKTIDIYWLFDDGGLTLLIPYLLHRKKRWGKC
KIRVFVGGQINRMDEERKAIISLLSKFRLGFHEVHVLPDINQKPQVEHTKRFEDMIAPFR
LNDGFKDEATVAEMRRDYPWKISDEEINKNRIKSLRQVRLNEILLDYSRDAALIILTLPI
GRKGKCPSSLYMAWLETLSQDLSPPVLLIRGNQENVLTFYCQ
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctacccgtgacagagatgccaggcgatgctctgtgcagtgggcgcttcacc
atcagcacgctgctggggggtgacgagcccccaccagctgcctgtgacaatagccagccc
agccatttgacccatggcagcaccttgtacctacgcacctttggttacaacactatagat
gtggtacccgcctacgaacactacgctaacagcgctctgcccggcgagccccggaaggtg
cggcccaccctggctgacctgcactcgttcctcaagcaggaaggtagccacctgcatgcc
ctggcctttgatggacggccaggccatgagctgactgatggacttgtggaagacgagaca
ggcgccaacagcgagaagagccctggagaacctgtgcgtttcggctgggtcaagggagtg
atgatccgatgcatgctcaacatatggggtgtgatcctctatctgcggctgccctggatt
acggcgcaggcgggcattgtcctgacctggctcatcatcctgctgtcagtcatggtgaca
tctatcaccggcctctctatctcggccatctccaccaatggcaaggtcaagtcgggtggt
acctatttcctaatttctcggagtctgggacctgagctggggggctccattggcctcatc
ttcgcctttgccaatgccgtgggtgtggccatgcacactgtgggctttgcagagaccgta
cgagacctacttcaggagaacggcacacccattgtagaccccatcaatgacatccgcatc
atcggtgtggtcacggtcactgtgctgctggccatctcgctggctgggatggagtgggag
tccaaggcccaggtgctgttctttcttgtcatcatggtctcttttgccaactacctggtg
ggcacgctgatcccagcatctaaggacaaagcctccaaaggtttctacagctaccatggg
gacatttttgttcagaacctggtacccgactggagaggcatcgatggtagcttcttcggg
atgttctccatcttcttcccttcagccacaggcattctggcaggggccaacatctctggg
gacctcaaggaccctgctgtcgctattcccaagggaacactcatggccattttctggacc
accatttcctaccttgccatctcggccaccatcgggtcctgtgtggtgagggatgcctct
ggggacgtgaacgacaccgtaactcctggcccaggcctctgtgaagggctagcctgcggt
tatggctggaacttcacggaatgctcccagcagcacagctgccgctatggcctcatcaac
tactaccagaccatgagcatggtgtctgccttcgcacccctgatcacagccggcatcttt
ggggccaccctgtcctcggccttggcctgtcttgtctcagctgccaaggtcttccagtgc
ctgtgcgaagaccagctgtaccctctgattggcttctttggcaagggctatgggaagaac
aaggaacctgtgcgtggctacttgctggcctacgccatcgcggtggccttcatcatcatt
gctgagctcaacaccatcgctcccatcatttctaacttcttcctctgctcctacgccctc
atcaacttcagctgcttccatgcctccatcaccaactcacctggatggagaccctccttc
cgatactacagcaagtgggcggcgctgtttggggcagtgatctccgtggtcatcatgttc
ctgcttacctggtgggcagctctcattgccattggagtcgttctcttcctcctgctctat
gtgatctacaagaagccagaggtaaactggggctcctcagtgcaggctggctcctacaac
ctggccctgagctactccgtgggcctcaatgaggtggaagaccacatcaagaactatcgc
ccccagtgcctggtgcttacaggaccccccaacttccgcccagctcttgtggactttgtg
agcacgtttacccagaacctaagcctgatgatctgtggccacgtgctcattgcacccggc
aaacagagagtgccggagctccgactcatcgccagcggacacaccaagtggctgaacaag
aggaagatcaaggccttctactctgacgtcatagctgaggacttgcgcagtggcgtccag
attctcatgcaggcctcgggtctgggaagaatgaaacctaacattctggtggttggcttc
aagaagaactggcagtctgcccacccagccacactggaggactacattggcatcctgcac
gatgcctttgacttcaactacggggtgtgcatcatgaggatgcgtgaggggctcaatgtc
tctgaggcgctgcagacgcacacagccccagaggcactggtacaggaggagcagaccagc
accatcttccagtcggagcaaggcaagaagaccattgacatctactggctgtttgacgat
ggaggcctcaccctcctcatcccttatctcctgcaccgcaagaagagatggggcaaatgc
aagatccgcgtgttcgttgggggccagatcaacaggatggatgaagagagaaaggcgatc
atttctctgttgagcaagttcagactgggattccatgaagtccacgtccttcctgacatc
aaccagaagccccaggtggagcacaccaagcggtttgaggacatgattgcccccttccgt
ctcaatgacggcttcaaggacgaggccactgttgccgagatgaggagggactatccctgg
aagatctcagacgaggagattaataagaacagaattaagtcccttcggcaggtgaggctg
aatgagattctcctggattactcccgggatgctgctctgatcatccttaccttgcccatt
ggaaggaaggggaagtgccccagttcactgtacatggcctggctggagaccctgtcccag
gacctcagtcctcccgttctcctcatccgaggtaaccaggagaacgtgctcaccttttac
tgccagtga

DBGET integrated database retrieval system