KEGG   Rattus norvegicus (rat): 54349Help
Entry
54349             CDS       T01003                                 

Gene name
Aox1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    54349 (Aox1)
   00350 Tyrosine metabolism
    54349 (Aox1)
   00380 Tryptophan metabolism
    54349 (Aox1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    54349 (Aox1)
   00760 Nicotinate and nicotinamide metabolism
    54349 (Aox1)
   00830 Retinol metabolism
    54349 (Aox1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    54349 (Aox1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     54349 (Aox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q31
AA seq 1333 aa AA seqDB search
MDPPQLLFYVNGQKVVENNVDPEMMLLPYLRKNLRLTGTKYGCGGGGCGACTVMISRYNP
STKSIRHHPVNACLTPICSLYGTAVTTVEGIGNTRTRLHPVQERIAKCHSTQCGFCTPAR
VMSMYALLRNHPEPSLDQLTDALGGNLCRCTGYRPIIDACKTFCRASGCCESKENGVCCL
DQGINGSAEFQEGDETSPELFSEKEFQPLDPTQELIFPPELMRIAEKQPPKTRVFYSNRM
TWISPVTLEELVEAKFKYPGAPIVMGYTSVGPEVKFKGVFHPIIISPDRIEELSIINQTG
DGLTLGAGLSLDQVKDILTDVVQKLPEETTQTYRALLKHLRTLAGSQIRNMASLGGHIVS
RHLDSDLNPLLAVGNCTLNLLSKDGKRQIPLSEQFLRKCPDSDLKPQEVLVSVNIPCSRK
WEFVSAFRQAQRQQNALAIVNSGMRVLFREGGGVIKELSILYGGVGPTTIGAKNSCQKLI
GRPWNEEMLDTACRLVLDEVTLAGSAPGGKVEFKRTLIISFLFKFYLEVLQGLKREDPGH
YPSLTNNYESALEDLHSKHHWRTLTHQNVDSMQLPQDPIGRPIMHLSGIKHATGEAIYCD
DMPAVDRELFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIITADHLQDTTTFGTETLLAT
DKVHCVGQLVCAVIADSETRAKQAAKHVKVVYRDLEPLILTIEEAIQHKSFFESERKLEC
GNVDEAFKIADQILEGEIHIGGQEHFYMETQSMLVVPKGEDGEIDIYVSTQFPKHIQDIV
AATLKLSVNKVMCHVRRVGGAFGGKVGKTSIMAAITAFAASKHGRAVRCTLERGEDMLIT
GGRHPYLGKYKVGFMRDGRIVALDVEHYCNGGSSLDESLWVIEMGLLKMDNAYKFPNLRC
RGWACRTNLPSHTALRGFGFPQAGLVTEACVTEVAIRCGLSPEQVRTINMYKQIDNTHYK
QEFSAKTLFECWRECMAKCSYSERKTAVGKFNAENSWKKRGMAVIPLKFPVGVGSVAMGQ
AAALVHIYLDGSALVSHGGIEMGQGVHTKMIQVVSRELKMPMSSVHLRGTSTETVPNTNA
SGGSVVADLNGLAVKDACQTLLKRLEPIISKNPQGTWKDWAQTAFDQSVSLSAVGYFRGY
ESNINWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGHSINPALDIGQVE
GAFIQGMGLYTIEELSYSPQGILYSRGPNQYKIPAICDIPTEMHISFLPPSEHSNTLYSS
KGLGESGVFLGCSVFLAIHDAVRAARQERGISGPWKLTSPLTPEKIRMACEDKFRKMIPR
DEPGSYVPWNIPV
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atggatcccccgcagctgctcttctacgtgaatggccagaaggtggtagaaaacaatgtt
gatcctgagatgatgcttttaccgtacctgaggaagaacctccgactcacgggaactaag
tatggctgtggaggcggcggctgcggtgcctgcacagtgatgatctcacggtacaacccc
agcaccaagagcatcaggcatcatcctgtcaatgcctgtctgacccccatctgctctctg
tacggtacagcagtcaccacagtagagggcataggcaacaccaggaccagacttcatcct
gttcaggagaggatcgccaagtgtcacagcacccagtgtgggttctgtacccctgcgagg
gtgatgtccatgtatgctctgctcaggaaccacccagagccctctctagatcagttaact
gatgcccttggggggaatctgtgccgctgtaccggatacaggcccataattgacgcttgc
aagactttctgtagagcttctggttgctgtgaaagtaaagaaaatggggtgtgctgtttg
gatcaaggaataaatggatcggcagaatttcaggaaggagatgagacaagtccagaactg
ttctcggaaaaggaatttcagccactggacccaacccaagagctgatatttcctccagag
ctaatgagaatagccgagaaacagccaccaaagaccagagtgttctacagtaatagaatg
acatggatctccccggtgaccctggaggaacttgtggaagctaagttcaagtatcctggg
gcccccattgtcatggggtacacctctgtggggcctgaagtaaagtttaaaggtgtcttc
caccccatcataatttctcctgacagaattgaagagctgagtatcataaaccagactggg
gatgggctgaccctgggtgctggcctcagcctggaccaggtgaaggacattctcactgac
gtggtccagaagcttccagaagagacgacacagacataccgtgcgctcctgaagcacctg
agaactctggctggctctcagatcaggaatatggcttctttagggggccacatcgtgagc
agacatctggactcggatctgaatccccttctggctgtgggtaattgtaccctcaactta
ctatccaaagatggaaaacggcagatccctttaagtgagcagtttctccgcaagtgtcct
gactcggatcttaagcctcaggaagtcttggtctcagtgaacatcccctgttccaggaag
tgggagtttgtgtcagccttccgacaagcccagagacagcagaatgcactagcgattgtc
aactctggaatgagagtcctttttagagaaggaggtggcgtcattaaagagttatccatt
ttgtatggaggtgtcggtccaaccaccatcggtgccaagaactcctgtcagaaactcatt
ggaaggccctggaatgaagagatgctggacacagcatgcaggctggttttggatgaagtc
acccttgcaggttcagctcctggtgggaaggtggagttcaagaggaccctcatcatcagc
ttccttttcaagttctacctggaggtgctgcagggtctgaagagggaggacccaggtcac
tatcctagcttgacaaacaattatgagagtgctttagaagatctccattcaaaacatcac
tggagaacattaacccaccagaacgtggattcgatgcagcttcctcaggacccaattggc
cgtcccatcatgcacctttctggtattaagcacgctaccggcgaggccatctactgtgac
gacatgcctgcagtagaccgggagcttttcctgacttttgtaacaagttcaagagcacac
gctaagattgtgtccattgatctgtcagaagctctcagcctgccaggcgtggtggacatc
attactgcggatcatcttcaggacacaaccaccttcggcacagagacgcttctggccaca
gataaggtccactgcgtgggccaacttgtctgtgccgtgattgcggattctgagacacgg
gcaaagcaagcggcgaagcacgtgaaggtggtctaccgagacttggagcctctgatccta
actattgaggaagctatacaacacaagtccttcttcgagtcagaacggaagctggagtgt
ggaaatgttgatgaagcgtttaaaattgctgatcaaattcttgaaggtgagatacacata
ggcggccaggaacatttttatatggaaacccaaagcatgcttgttgtccccaaaggagag
gacggagagattgacatctatgtgtccacacagttccccaagcatatacaggatatagtt
gctgcaaccttgaagctttcagtcaacaaggtcatgtgtcatgtaaggcgtgttggtggg
gcgttcggagggaaggtaggcaagaccagcatcatggcggccatcactgcattcgctgcc
agcaaacacggtcgcgcggtccgctgcactctggaacgaggggaagacatgttgataact
gggggccgccatccttaccttggaaagtataaagttggattcatgagggacggcagaatc
gtggccctggatgtggagcactattgcaatggagggagctccctggatgagtccttatgg
gtgatagaaatggggcttctgaagatggacaacgcttacaagtttcccaatctacgctgc
cggggctgggcctgcagaaccaacctcccgtcccacactgctctgcgtgggtttggcttt
cctcaggcagggctggtcaccgaagcctgtgtcacagaagtggcaatcagatgtggcctg
tctcctgagcaggttcgaaccataaatatgtacaagcaaattgataatacccattacaag
caagaattcagcgccaagaccctctttgagtgctggagagaatgcatggccaagtgttcc
tactctgagaggaaaacggctgtaggaaaattcaatgcagagaattcctggaagaagagg
ggaatggccgtgattccattgaagtttcctgtgggtgttggctcagtagccatgggacag
gcggctgccctggtccatatttatcttgatggctctgcactggtctctcacggtgggatt
gagatggggcagggtgtccacactaaaatgatccaggtggtcagccgggaattaaagatg
ccaatgtcgagtgtccacctgcgtgggacaagcacagaaaccgtccccaacaccaatgca
tctggaggctctgtggtggcagatctcaatggattggcagtaaaggatgcttgccagacc
cttctaaaacgccttgagcccatcatcagcaagaacccccagggaacttggaaggattgg
gcccagactgcttttgaccagagcgtcagtctctcggctgttggatatttcaggggctac
gagtcgaatataaactgggagaaaggggaaggccatcccttcgaatactttgtgtatgga
gctgcctgctcagaggttgaaatagactgcctgaccggggaccataagaatatcagaaca
gacatcgtgatggatgttggccacagcataaacccagcccttgacataggccaggttgaa
ggtgcatttattcaaggaatgggactttacacgatagaggagctgagctactctcctcag
ggcattctgtacagtcgtggtccaaaccagtacaagatccctgccatctgcgacatcccc
accgagatgcacatttcttttttgcccccatccgaacactcaaacaccctgtattcatct
aagggtctgggagagtctggggtgttcctgggctgttcggtatttcttgccatccatgac
gcagtgagggcagcgcggcaggagagaggcatctctggaccatggaagctcactagtcct
ctgactccagagaaaatcagaatggcttgtgaagataagttcagaaaaatgattccaaga
gatgaacctggatcctatgttccctggaacatacctgtgtga

DBGET integrated database retrieval system