KEGG   Rattus norvegicus (rat): 54398Help
Entry
54398             CDS       T01003                                 

Gene name
Ppt2
Definition
palmitoyl-protein thioesterase 2 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    54398 (Ppt2)
  Lipid metabolism
   00062 Fatty acid elongation
    54398 (Ppt2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    54398 (Ppt2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     54398 (Ppt2)
Lipid biosynthesis proteins [BR:rno01004]
 Fatty acid synthase
  Component type
   54398 (Ppt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
20p12
AA seq 302 aa AA seqDB search
MPGLWRQRLPSAWALLLLPFLPLLLPAAPAPHRGSYKPVIVVHGLFDSSYSFRHLLDYIN
ETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMEKAPEGVHLICYSQGGLVCRAL
LSVMDEHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWH
DPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITPWQSSFFG
FYDANETVLEMEEQPVYLRDSFGLKTLLARGAIVRCPMAGVSHTTWHSNRTLYDACIEPW
LS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccggggctatggaggcagaggcttccttcggcttgggctttgcttctcctgcctttc
ctgccgctgctgttgcccgcagcccccgcaccccaccgcgggtcctacaagccagtgatc
gtggtgcatgggctctttgacagttcatacagcttccgccacctgctggactacatcaat
gagacacaccccgggactgtggtgacagtgcttgatctcttcgatggcagagagagcttg
cgacccctgtgggaacaggttcaagggttccgagaggctgtggtccccatcatggaaaag
gcccctgagggggtacacctcatctgctactcccagggaggcctggtgtgccgcgcattg
ctgtctgtcatggatgagcacaatgtggattccttcatctccctttcttctccacagatg
ggacagtatggagacacggactatttgaagtggctgttccctacgtccatgcggtctaac
ctctatcggatctgctatagcccctggggccaggaattttccatttgcaactactggcac
gaccctcaccacgatgacttgtacctcaacgccagcagctttctggccctcatcaatggg
gagagagaccatccgaatgccactgcatggcggaagaacttccttcgtgtgggccgtctg
gtgctgattgggggtccggacgatggagtcatcactccctggcaatctagcttctttggt
ttctatgatgccaacgagacggtcttggagatggaggaacagccggtgtatcttcgagac
tcttttgggttgaagactctcttggcccggggggccatagtgagatgccccatggctggg
gtctctcacaccacctggcactccaatcgcacgctctatgacgcttgcattgagccctgg
ctctcctga

DBGET integrated database retrieval system