KEGG   Rattus norvegicus (rat): 56718Help
Entry
56718             CDS       T01003                                 

Gene name
Mtor, Frap1, RAFT1
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04066  HIF-1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04371  Apelin signaling pathway
rno04630  Jak-STAT signaling pathway
rno04659  Th17 cell differentiation
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04920  Adipocytokine signaling pathway
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno05165  Human papillomavirus infection
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05221  Acute myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    56718 (Mtor)
   04371 Apelin signaling pathway
    56718 (Mtor)
   04630 Jak-STAT signaling pathway
    56718 (Mtor)
   04066 HIF-1 signaling pathway
    56718 (Mtor)
   04072 Phospholipase D signaling pathway
    56718 (Mtor)
   04151 PI3K-Akt signaling pathway
    56718 (Mtor)
   04152 AMPK signaling pathway
    56718 (Mtor)
   04150 mTOR signaling pathway
    56718 (Mtor)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    56718 (Mtor)
   04136 Autophagy - other eukaryotes
    56718 (Mtor)
  Cell growth and death
   04218 Cellular senescence
    56718 (Mtor)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    56718 (Mtor)
  Endocrine system
   04910 Insulin signaling pathway
    56718 (Mtor)
   04920 Adipocytokine signaling pathway
    56718 (Mtor)
   04919 Thyroid hormone signaling pathway
    56718 (Mtor)
  Aging
   04211 Longevity regulating pathway - mammal
    56718 (Mtor)
   04213 Longevity regulating pathway - multiple species
    56718 (Mtor)
  Environmental adaptation
   04714 Thermogenesis
    56718 (Mtor)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    56718 (Mtor)
   05230 Central carbon metabolism in cancer
    56718 (Mtor)
   05231 Choline metabolism in cancer
    56718 (Mtor)
   05206 MicroRNAs in cancer
    56718 (Mtor)
   05205 Proteoglycans in cancer
    56718 (Mtor)
   05210 Colorectal cancer
    56718 (Mtor)
   05212 Pancreatic cancer
    56718 (Mtor)
   05225 Hepatocellular carcinoma
    56718 (Mtor)
   05226 Gastric cancer
    56718 (Mtor)
   05214 Glioma
    56718 (Mtor)
   05221 Acute myeloid leukemia
    56718 (Mtor)
   05215 Prostate cancer
    56718 (Mtor)
   05224 Breast cancer
    56718 (Mtor)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    56718 (Mtor)
   04931 Insulin resistance
    56718 (Mtor)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    56718 (Mtor)
   05165 Human papillomavirus infection
    56718 (Mtor)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    56718 (Mtor)
   01522 Endocrine resistance
    56718 (Mtor)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56718 (Mtor)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   56718 (Mtor)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    56718 (Mtor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 56718
NCBI-ProteinID: NP_063971
RGD: 68371
Ensembl: ENSRNOG00000009615
UniProt: P42346
Position
5q36
AA seq 2549 aa AA seqDB search
MLGTGPATATAGAATSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNSTRIGRFANYLRNLLPSSDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPTKSTLVESR
CCRDLMEEKFDQVCQWVLKCRSSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKTVQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVASITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFVIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSQGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSSQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAASGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTTATTAASAAAATSTEGSNSESEAESNESSP
TPSPLQKKVTEDLSKTLLLYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRTTC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNAKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt NT seq  +upstreamnt  +downstreamnt
atgcttgggacaggccctgccacggccaccgccggtgccgccacatctagcaacgtgagc
gttctgcagcagttcgccagtgggctgaagagccggaatgaggagaccagggccaaagca
gccaaggagctccagcactatgtcaccatggaacttcgagagatgagtcaggaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaactggtttccagctcagacgcc
aatgagaggaagggtggcatcttggccattgccagcctcattggagtggaaggtgggaat
tccaccaggattggcagatttgccaactaccttcggaacctcctcccctcaagtgatcca
gttgtcatggagatggcatccaaggccattggccgccttgcaatggcaggggacactttc
actgctgagtatgtggagtttgaagtgaagcgagccttggagtggctgggtgctgaccga
aatgagggccggagacatgcagctgtcctcgttctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagttcagcccttctttgacaacatttttgtggctgtgtgggac
cccaagcaggccatccgtgaaggagctgtggctgcccttcgtgcctgtctgattcttacc
acgcagcgggagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaaaggttttgatgagaccctggccaaagagaagggtatgaaccgagatgatcga
atccacggggccttgctgatcctcaacgagctcgtccgaatcagcagcatggagggagag
cgtctgagagaggagatggaggaaatcacccagcagcagctggtacatgacaagtactgc
aaagacctaatgggctttgggacaaagcctcggcacatcactcccttcaccagcttccag
gctgtgcagccccagcagtcaaacgccttggtgggactgctggggtacagctcccaccaa
ggcctaatggggtttggggcttcccccagccctacaaagtccactctggtggaaagccgt
tgttgcagagacttgatggaagagaaatttgatcaggtgtgccagtgggtgctgaaatgt
aggagcagcaagaactcactgatccaaatgacaatccttaatctgttgccccgcttggct
gcattccgaccgtctgccttcacagatacccagtacctgcaagacaccatgaaccatgtc
ctgagctgtgtcaagaaggaaaaggaacggaccgcagcgttccaggccctagggctgctt
tctgtggcggtgaggtccgagtttaaggtctacctgccccgagtacttgacatcatccga
gcagccctgcctccaaaggactttgcccacaagaggcagaaaactgtgcaggtggatgcc
acagtgttcacgtgcatcagcatgctggcgcgggccatggggccaggcatccagcaggac
atcaaggagctgctggagcccatgttggcagtgggcctgagccctgcgctcactgctgtg
ctctatgacctgagccggcagattccgcagctgaagaaagatattcaggacgggcttctg
aagatgctgtccctggtccttatgcacaaacccctgcggcacccgggcatgcccaaaggc
ctggcccaccagctggcctccccaggtcttaccaccctccctgaggccagcgacgtggcc
agcatcactcttgcccttcgaactctcggcagctttgaatttgaaggccactctctgacc
cagttcgtccgacactgcgcagatcatttcctgaacagtgagcacaaggagatccgcatg
gaagcagcccgcacctgctcccgcctgctcacaccctccatccacctcatcagcggccat
gcccatgtggttagccagaccgcagtgcaagtggtagcagatgtgctcagcaagctgctt
gtggtcggcataacagatcctgatcctgatatccgctactgtgtcttggcctccctggat
gagcgcttcgatgcccacttggcccaggcagaaaacttacaagctctgtttgtggctctg
aatgaccaggtctttgagatccgagagctggccatctgcactgtgggccgactcagtagc
atgaacccagcctttgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtggcattgggagaatcaaggagcagagtgcccgcatgctggggcacctg
gtctccaatgccccccgcctcatccgcccctatatggagcctattctgaaggctttaatt
ttgaaactcaaagatccagaccctgacccaaacccgggcgtgatcaataacgtgttggcc
actataggagaactggctcaggttagcggcctggagatgaggaagtgggtggacgagctc
tttgtcatcatcatggacatgctgcaggactcctctcttctggccaaaagacaggtggct
ttgtggaccctgggacagttggtggccagtactggctacgtggtggagccctacaggaag
taccccactctgcttgaagtgctgctgaattttctgaagacggagcagaaccagggcact
cggagagaggccatccgagtgttagggctcctcggggctttggacccctacaagcacaaa
gtgaacatcggcatgattgaccagtcccgagatgcttctgctgtcagcctgtcagaatcc
aagtcaagtcaagattcctctgactacagcaccagtgaaatgctggtcaacatgggaaac
ctgccactggacgagttctaccccgccgtgtccatggtggccttgatgcggatcttccga
gaccagtccctctctcaccaccacaccatggtggttcaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacgttccttaacgtc
atccgagtctgtgatggggccatccgggaatttctgttccagcagctgggaatgctggtg
tcctttgtgaagagccacatccgtccctacatggatgaaatagtcaccctcatgagagaa
ttttgggtcatgaacacctcaatccagagcacaatcattcttctcattgagcaaatcgtg
gtggctcttggaggtgaatttaagctctacctgccccagctgatcccacacatgctgcgt
gtcttcatgcatgacaacagccagggccgcatagtctccatcaagctgttagcagcgatc
cagctgtttggcgccaacctggatgactatctgcacttgttgttgcctccgatcgtgaaa
ttgtttgatgcccctgaagttccactgccgtcgagaaaggcagcgttggagacagtggac
cgcctgacagagtccctggatttcactgactatgcctcccgcatcattcacccgattgtt
cgcacgctagaccagagcccagagctgcgctccacagccatggacaccctgtcttcactt
gtgtttcaactagggaagaagtaccagatcttcattccaatggtgaataaagtccttgtg
cgacaccggatcaatcaccagcgctacgacgtgctgatctgcagaatcgtcaaggggtac
acgcttgctgatgaagaagaagaccctttgatttaccagcatcgaatgctaaggagcagc
cagggagatgccctggccagtggaccagttgaaacaggacccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaggacgactgg
ctggagtggctgcgacgcttgagtctggagctgctgaaggattcctcatcaccttccctg
cgctcatgctgggccctggcccaggcctacaaccccatggccagggatctcttcaacgct
gcgtttgtgtcctgctggtctgaactgaatgaagaccaacaagatgagctcatcaggagc
attgagttggctctcacttctcaagacattgctgaagtcacacaaaccctcttgaacttg
gctgagttcatggagcacagtgacaagggccccctaccactgagagatgacaatggcatc
gtgctgttgggtgagagagctgccaagtgccgggcatatgccaaagcactacactacaaa
gagctggagttccagaaggggcccacgcctgccatacttgagtccctcatcagcattaat
aataaactgcagcagcctgaggcagcgtccggggtgttagagtacgccatgaaacacttc
ggagagctggagatccaggccacctggtatgagaagttgcatgagtgggaggacgccctt
gtggcctacgacaagaagatggacacgaacaaggatgacccagagctgatgctgggccgc
atgcgctgtctcgaggccttgggagaatggggccagcttcatcagcagtgctgtgaaaag
tggactctggttaatgacgagacccaggctaagatggcccggatggctgctgcagcagca
tggggtttaggtcagtgggacagcatggaggagtacacctgtatgattcctcgggatact
cacgatggagcattctacagagcagtgttggcactgcatcaggatctcttctccttggct
caacagtgcattgacaaggccagggacctgctggacgccgagctgactgccatggcaggg
gagagctacagccgagcctatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaactcgtcccggagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtagaggactggcagaaaatcctcatggtccgg
tcccttgtggtcagccctcacgaggacatgagaacctggctcaagtacgcaagcctgtgt
ggcaagagcggcagactggctcttgctcataaaaccttagtgttgctcttgggagttgat
ccatctcggcaacttgaccatcctctgccaacagttcaccctcaagtgacctatgcctac
atgaaaaacatgtggaaaagcgctcggaagattgatgccttccagcacatgcagcacttt
gtgcagaccatgcagcagcaggcccagcacgccattgccacagaggaccagcagcacaag
caggagctgcataagctcatggccaggtgttttctgaaacttggggagtggcagctgaac
ctccagggcatcaacgagagcaccatccccaaggtgctacagtactacagtgctgccaca
gagcatgaccgcagctggtataaggcttggcacgcatgggcagtgatgaactttgaagcc
gtgctacactacaaacatcagaaccaagcccgcgatgagaagaagaaactgcgccatgcc
agcggggccaacatcaccaatgccaccaccactgccaccaccgctgcctccgctgccgct
gccaccagcacagagggcagcaacagtgaaagtgaagccgagagcaatgagagcagcccc
accccgtcccctctgcagaagaaggtcactgaggatttgtccaaaaccctcttgttgtac
actgtccctgctgtccaaggcttcttccgttctatctccttgtcgagaggcaacaacctc
caggatacactcagagtcctcaccttgtggtttgattatggtcactggccagatgtcaat
gaagccctggtggaaggggtgaaggccatacagattgacacttggttacaggttatacct
cagctcattgcaagaattgacacgcccagacccttggtgggccggctcattcaccagctc
ctcacagatattggtcggtaccacccacaggccctcatctaccccctgacggtggcttct
aagtctaccaccacagcccgtcacaatgcagccaacaagatcctgaagaacatgtgcgag
cacagcaacacgctagtccagcaggccatgatggtgagtgaagagctgattcgagtagcc
atcctctggcatgagatgtggcatgaaggcctagaagaggcctctcgcttgtactttggg
gagaggaacgtcaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaacgc
ggtccccagaccctgaaggaaacgtcctttaatcaggcatatggtcgagatttaatggag
gcacaagaatggtgccgaaagtacatgaaatcagggaacgtcaaggacctcacccaagcc
tgggacctctactatcacgtgttcagacggatctccaagcagctaccacagctcacatcc
ctggagctgcagtatgtgtcccccaaacttttgatgtgcagagaccttgaattggctgtg
ccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagccccgtctttg
caagtcatcacatccaagcagaggcctcggaagctgaccctgatgggcagcaatgggcac
gagtttgttttcctcctgaaaggccatgaagatctgcggcaggacgagcgagtgatgcag
ctctttggcctggtgaacacactcctagccaatgacccaacttctcttcgaaagaacctc
agcatccagagatacgccgtcattcctctgtccaccaactcgggcctgattggctgggtg
ccccactgtgacacgctgcatgccctcatccgggactacagagagaagaagaagatcctg
ctgaacatcgagcaccgcatcatgctgcggatggctcctgactatgaccacctgactctg
atgcagaaggtggaggtgtttgagcatgctgtcaacaacacagccggggatgacctggcc
aagctgctgtggctgaaaagccccagctcagaggtgtggtttgaccgaagaaccaattat
actcgctccctggctgtcatgtccatggttggatacattttaggccttggagacaggcac
ccatccaacctgatgctggaccggctgagtggaaagatcctgcacattgactttggggac
tgctttgaggttgctatgaccagagagaaatttccagaaaagattccatttagactaaca
agaatgttgaccaatgctatggaggttaccggtctcgatggcaactatagaaccacatgc
cacacagtgatggaggtgcttcgggagcacaaggacagtgtcatggctgtgctagaagcc
tttgtctatgaccctctgctgaattggaggctgatggacacaaatgccaaaggcaacaag
cggtcccgaaccaggacagactcctattctgcaggccagtcagtagaaattttggacggt
gtagaacttggagaaccagcccataagaaaacagggaccactgtgccagaatccatccat
tctttcattggagatggtttggtgaaaccagaagccttaaacaagaaagctattcagatt
attaacagggttcgagataagctcactggtcgggatttctctcatgatgacactttggat
gttccaacccaagtggaactgcttatcaagcaagcgacatctcatgagaacctctgccag
tgctacattggctggtgtcctttctggtaa

DBGET integrated database retrieval system