KEGG   Rattus norvegicus (rat): 56718Help
Entry
56718             CDS       T01003                                 

Gene name
Mtor, Frap1, RAFT1
Definition
mechanistic target of rapamycin (serine/threonine kinase) (EC:2.7.11.1)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
rno  Rattus norvegicus (rat)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    56718 (Mtor)
   04066 HIF-1 signaling pathway
    56718 (Mtor)
   04151 PI3K-Akt signaling pathway
    56718 (Mtor)
   04152 AMPK signaling pathway
    56718 (Mtor)
   04150 mTOR signaling pathway
    56718 (Mtor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    56718 (Mtor)
   04920 Adipocytokine signaling pathway
    56718 (Mtor)
   04919 Thyroid hormone signaling pathway
    56718 (Mtor)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    56718 (Mtor)
   05206 MicroRNAs in cancer
    56718 (Mtor)
   05205 Proteoglycans in cancer
    56718 (Mtor)
   05214 Glioma
    56718 (Mtor)
   05221 Acute myeloid leukemia
    56718 (Mtor)
   05215 Prostate cancer
    56718 (Mtor)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    56718 (Mtor)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   56718 (Mtor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 2549 aa AA seqDB search
MLGTGPATATAGAATSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNSTRIGRFANYLRNLLPSSDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPTKSTLVESR
CCRDLMEEKFDQVCQWVLKCRSSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKTVQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVASITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFVIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSQGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSSQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAASGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTTATTAASAAAATSTEGSNSESEAESNESSP
TPSPLQKKVTEDLSKTLLLYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRTTC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNAKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt NT seq  +upstreamnt  +downstreamnt
atgcttgggacaggccctgccacggccaccgccggtgccgccacatctagcaacgtgagc
gttctgcagcagttcgccagtgggctgaagagccggaatgaggagaccagggccaaagca
gccaaggagctccagcactatgtcaccatggaacttcgagagatgagtcaggaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaactggtttccagctcagacgcc
aatgagaggaagggtggcatcttggccattgccagcctcattggagtggaaggtgggaat
tccaccaggattggcagatttgccaactaccttcggaacctcctcccctcaagtgatcca
gttgtcatggagatggcatccaaggccattggccgccttgcaatggcaggggacactttc
actgctgagtatgtggagtttgaagtgaagcgagccttggagtggctgggtgctgaccga
aatgagggccggagacatgcagctgtcctcgttctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagttcagcccttctttgacaacatttttgtggctgtgtgggac
cccaagcaggccatccgtgaaggagctgtggctgcccttcgtgcctgtctgattcttacc
acgcagcgggagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaaaggttttgatgagaccctggccaaagagaagggtatgaaccgagatgatcga
atccacggggccttgctgatcctcaacgagctcgtccgaatcagcagcatggagggagag
cgtctgagagaggagatggaggaaatcacccagcagcagctggtacatgacaagtactgc
aaagacctaatgggctttgggacaaagcctcggcacatcactcccttcaccagcttccag
gctgtgcagccccagcagtcaaacgccttggtgggactgctggggtacagctcccaccaa
ggcctaatggggtttggggcttcccccagccctacaaagtccactctggtggaaagccgt
tgttgcagagacttgatggaagagaaatttgatcaggtgtgccagtgggtgctgaaatgt
aggagcagcaagaactcactgatccaaatgacaatccttaatctgttgccccgcttggct
gcattccgaccgtctgccttcacagatacccagtacctgcaagacaccatgaaccatgtc
ctgagctgtgtcaagaaggaaaaggaacggaccgcagcgttccaggccctagggctgctt
tctgtggcggtgaggtccgagtttaaggtctacctgccccgagtacttgacatcatccga
gcagccctgcctccaaaggactttgcccacaagaggcagaaaactgtgcaggtggatgcc
acagtgttcacgtgcatcagcatgctggcgcgggccatggggccaggcatccagcaggac
atcaaggagctgctggagcccatgttggcagtgggcctgagccctgcgctcactgctgtg
ctctatgacctgagccggcagattccgcagctgaagaaagatattcaggacgggcttctg
aagatgctgtccctggtccttatgcacaaacccctgcggcacccgggcatgcccaaaggc
ctggcccaccagctggcctccccaggtcttaccaccctccctgaggccagcgacgtggcc
agcatcactcttgcccttcgaactctcggcagctttgaatttgaaggccactctctgacc
cagttcgtccgacactgcgcagatcatttcctgaacagtgagcacaaggagatccgcatg
gaagcagcccgcacctgctcccgcctgctcacaccctccatccacctcatcagcggccat
gcccatgtggttagccagaccgcagtgcaagtggtagcagatgtgctcagcaagctgctt
gtggtcggcataacagatcctgatcctgatatccgctactgtgtcttggcctccctggat
gagcgcttcgatgcccacttggcccaggcagaaaacttacaagctctgtttgtggctctg
aatgaccaggtctttgagatccgagagctggccatctgcactgtgggccgactcagtagc
atgaacccagcctttgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtggcattgggagaatcaaggagcagagtgcccgcatgctggggcacctg
gtctccaatgccccccgcctcatccgcccctatatggagcctattctgaaggctttaatt
ttgaaactcaaagatccagaccctgacccaaacccgggcgtgatcaataacgtgttggcc
actataggagaactggctcaggttagcggcctggagatgaggaagtgggtggacgagctc
tttgtcatcatcatggacatgctgcaggactcctctcttctggccaaaagacaggtggct
ttgtggaccctgggacagttggtggccagtactggctacgtggtggagccctacaggaag
taccccactctgcttgaagtgctgctgaattttctgaagacggagcagaaccagggcact
cggagagaggccatccgagtgttagggctcctcggggctttggacccctacaagcacaaa
gtgaacatcggcatgattgaccagtcccgagatgcttctgctgtcagcctgtcagaatcc
aagtcaagtcaagattcctctgactacagcaccagtgaaatgctggtcaacatgggaaac
ctgccactggacgagttctaccccgccgtgtccatggtggccttgatgcggatcttccga
gaccagtccctctctcaccaccacaccatggtggttcaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacgttccttaacgtc
atccgagtctgtgatggggccatccgggaatttctgttccagcagctgggaatgctggtg
tcctttgtgaagagccacatccgtccctacatggatgaaatagtcaccctcatgagagaa
ttttgggtcatgaacacctcaatccagagcacaatcattcttctcattgagcaaatcgtg
gtggctcttggaggtgaatttaagctctacctgccccagctgatcccacacatgctgcgt
gtcttcatgcatgacaacagccagggccgcatagtctccatcaagctgttagcagcgatc
cagctgtttggcgccaacctggatgactatctgcacttgttgttgcctccgatcgtgaaa
ttgtttgatgcccctgaagttccactgccgtcgagaaaggcagcgttggagacagtggac
cgcctgacagagtccctggatttcactgactatgcctcccgcatcattcacccgattgtt
cgcacgctagaccagagcccagagctgcgctccacagccatggacaccctgtcttcactt
gtgtttcaactagggaagaagtaccagatcttcattccaatggtgaataaagtccttgtg
cgacaccggatcaatcaccagcgctacgacgtgctgatctgcagaatcgtcaaggggtac
acgcttgctgatgaagaagaagaccctttgatttaccagcatcgaatgctaaggagcagc
cagggagatgccctggccagtggaccagttgaaacaggacccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaggacgactgg
ctggagtggctgcgacgcttgagtctggagctgctgaaggattcctcatcaccttccctg
cgctcatgctgggccctggcccaggcctacaaccccatggccagggatctcttcaacgct
gcgtttgtgtcctgctggtctgaactgaatgaagaccaacaagatgagctcatcaggagc
attgagttggctctcacttctcaagacattgctgaagtcacacaaaccctcttgaacttg
gctgagttcatggagcacagtgacaagggccccctaccactgagagatgacaatggcatc
gtgctgttgggtgagagagctgccaagtgccgggcatatgccaaagcactacactacaaa
gagctggagttccagaaggggcccacgcctgccatacttgagtccctcatcagcattaat
aataaactgcagcagcctgaggcagcgtccggggtgttagagtacgccatgaaacacttc
ggagagctggagatccaggccacctggtatgagaagttgcatgagtgggaggacgccctt
gtggcctacgacaagaagatggacacgaacaaggatgacccagagctgatgctgggccgc
atgcgctgtctcgaggccttgggagaatggggccagcttcatcagcagtgctgtgaaaag
tggactctggttaatgacgagacccaggctaagatggcccggatggctgctgcagcagca
tggggtttaggtcagtgggacagcatggaggagtacacctgtatgattcctcgggatact
cacgatggagcattctacagagcagtgttggcactgcatcaggatctcttctccttggct
caacagtgcattgacaaggccagggacctgctggacgccgagctgactgccatggcaggg
gagagctacagccgagcctatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaactcgtcccggagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtagaggactggcagaaaatcctcatggtccgg
tcccttgtggtcagccctcacgaggacatgagaacctggctcaagtacgcaagcctgtgt
ggcaagagcggcagactggctcttgctcataaaaccttagtgttgctcttgggagttgat
ccatctcggcaacttgaccatcctctgccaacagttcaccctcaagtgacctatgcctac
atgaaaaacatgtggaaaagcgctcggaagattgatgccttccagcacatgcagcacttt
gtgcagaccatgcagcagcaggcccagcacgccattgccacagaggaccagcagcacaag
caggagctgcataagctcatggccaggtgttttctgaaacttggggagtggcagctgaac
ctccagggcatcaacgagagcaccatccccaaggtgctacagtactacagtgctgccaca
gagcatgaccgcagctggtataaggcttggcacgcatgggcagtgatgaactttgaagcc
gtgctacactacaaacatcagaaccaagcccgcgatgagaagaagaaactgcgccatgcc
agcggggccaacatcaccaatgccaccaccactgccaccaccgctgcctccgctgccgct
gccaccagcacagagggcagcaacagtgaaagtgaagccgagagcaatgagagcagcccc
accccgtcccctctgcagaagaaggtcactgaggatttgtccaaaaccctcttgttgtac
actgtccctgctgtccaaggcttcttccgttctatctccttgtcgagaggcaacaacctc
caggatacactcagagtcctcaccttgtggtttgattatggtcactggccagatgtcaat
gaagccctggtggaaggggtgaaggccatacagattgacacttggttacaggttatacct
cagctcattgcaagaattgacacgcccagacccttggtgggccggctcattcaccagctc
ctcacagatattggtcggtaccacccacaggccctcatctaccccctgacggtggcttct
aagtctaccaccacagcccgtcacaatgcagccaacaagatcctgaagaacatgtgcgag
cacagcaacacgctagtccagcaggccatgatggtgagtgaagagctgattcgagtagcc
atcctctggcatgagatgtggcatgaaggcctagaagaggcctctcgcttgtactttggg
gagaggaacgtcaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaacgc
ggtccccagaccctgaaggaaacgtcctttaatcaggcatatggtcgagatttaatggag
gcacaagaatggtgccgaaagtacatgaaatcagggaacgtcaaggacctcacccaagcc
tgggacctctactatcacgtgttcagacggatctccaagcagctaccacagctcacatcc
ctggagctgcagtatgtgtcccccaaacttttgatgtgcagagaccttgaattggctgtg
ccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagccccgtctttg
caagtcatcacatccaagcagaggcctcggaagctgaccctgatgggcagcaatgggcac
gagtttgttttcctcctgaaaggccatgaagatctgcggcaggacgagcgagtgatgcag
ctctttggcctggtgaacacactcctagccaatgacccaacttctcttcgaaagaacctc
agcatccagagatacgccgtcattcctctgtccaccaactcgggcctgattggctgggtg
ccccactgtgacacgctgcatgccctcatccgggactacagagagaagaagaagatcctg
ctgaacatcgagcaccgcatcatgctgcggatggctcctgactatgaccacctgactctg
atgcagaaggtggaggtgtttgagcatgctgtcaacaacacagccggggatgacctggcc
aagctgctgtggctgaaaagccccagctcagaggtgtggtttgaccgaagaaccaattat
actcgctccctggctgtcatgtccatggttggatacattttaggccttggagacaggcac
ccatccaacctgatgctggaccggctgagtggaaagatcctgcacattgactttggggac
tgctttgaggttgctatgaccagagagaaatttccagaaaagattccatttagactaaca
agaatgttgaccaatgctatggaggttaccggtctcgatggcaactatagaaccacatgc
cacacagtgatggaggtgcttcgggagcacaaggacagtgtcatggctgtgctagaagcc
tttgtctatgaccctctgctgaattggaggctgatggacacaaatgccaaaggcaacaag
cggtcccgaaccaggacagactcctattctgcaggccagtcagtagaaattttggacggt
gtagaacttggagaaccagcccataagaaaacagggaccactgtgccagaatccatccat
tctttcattggagatggtttggtgaaaccagaagccttaaacaagaaagctattcagatt
attaacagggttcgagataagctcactggtcgggatttctctcatgatgacactttggat
gttccaacccaagtggaactgcttatcaagcaagcgacatctcatgagaacctctgccag
tgctacattggctggtgtcctttctggtaa

DBGET integrated database retrieval system