KEGG   Rattus norvegicus (rat): 574523Help
Entry
574523            CDS       T01003                                 

Gene name
Ugt1a5, UDPGT_1-5, Ugt1, Ugt1a6
Definition
UDP glucuronosyltransferase 1 family, polypeptide A5 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    574523 (Ugt1a5)
   00053 Ascorbate and aldarate metabolism
    574523 (Ugt1a5)
   00500 Starch and sucrose metabolism
    574523 (Ugt1a5)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    574523 (Ugt1a5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    574523 (Ugt1a5)
   00860 Porphyrin and chlorophyll metabolism
    574523 (Ugt1a5)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    574523 (Ugt1a5)
   00982 Drug metabolism - cytochrome P450
    574523 (Ugt1a5)
   00983 Drug metabolism - other enzymes
    574523 (Ugt1a5)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    574523 (Ugt1a5)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     574523 (Ugt1a5)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   574523 (Ugt1a5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
9q35
AA seq 531 aa AA seqDB search
MGLHVTLQGLAGLLLLLYALPWAEGGKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAP
EVTVHIKEEDFFTLQTYPVPYTRQGFRQQMMRNIKVVFETGNYVKTFLETSEILKNISTV
LLRSCMNLLHNGSLLQHLNSSSFDMVLTDPVIPCGAVLAKYLGIPTVFFLRYIPCGIDSE
ATQCPKPSSYIPNLLTMLSDHMTFLQRVKNMLYPLALKYICHFSFTRYESLASELLQREV
SLVEVLSHASVWLFRGDFVFDYPRPVMPNMVFIGGINCVIKKPLSQEFEAYVNASGEHGI
VVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLG
HPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADD
LENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLT
WYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgggactccatgtgaccctgcaaggattagctgggctgctgctgctgctgtatgccctg
ccctgggctgaaggtggaaaggtgctggtgtttcccatggagggcagccactggctgagc
atgagggatgtcgtgagggagctccacgcccgaggtcaccaggctgtggtcctggctcca
gaggtgactgtgcacatcaaagaagaggacttcttcaccctccaaacctaccctgttcca
tacacaagacaaggatttagacaacaaatgatgcgaaacattaaagtggtctttgaaaca
ggcaactatgtgaagacattccttgaaacatccgagattttgaaaaacatatcgacagtt
ctcttaaggtcttgtatgaatctattgcacaatgggtccctgctccagcatctgaattcc
agctcctttgacatggtcttaacagatcctgtgattccgtgtggggcagtgctggccaag
tacttgggtatccccactgtgttctttctacgatacattccctgtggcatagactctgag
gccacacaatgtccgaaaccttcctcttatattccgaacctactcacaatgctttctgac
cacatgactttcctgcaaagggtcaagaacatgctgtaccctctggccttgaagtacatt
tgccatttctcattcactcgctatgaaagcctggcctctgagcttttgcagagagaagtg
tctttagtggaggttctcagccatgcatctgtgtggctgttccgaggggactttgtgttc
gactacccgaggcctgtcatgcctaacatggtcttcattggaggcataaactgtgtcatc
aagaagcctctttctcaggaatttgaagcctatgtcaacgcctccggagaacatggcatc
gtggttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaatt
gctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagacca
tcgaaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggt
catccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaata
tgcaatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaag
cgcatggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgat
ttggaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgc
ctctccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtg
gagtacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacc
tggtaccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtg
gtcttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggt
cgagtgaagaaatcacacaaatccaagacccactga

DBGET integrated database retrieval system