KEGG   Rattus norvegicus (rat): 58840Help
Entry
58840             CDS       T01003                                 

Gene name
Mapk6, ERK3
Definition
mitogen-activated protein kinase 6 (EC:2.7.11.24)
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     58840 (Mapk6)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   58840 (Mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q24
AA seq 720 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTSYS
AEPCWQYPDHHENKYCDLECSHTCNYKTRSPSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKDKSDKRGKSKCERNGLVKAQIALEEASQQLAERERGQGFDFDAFIAGTVQLSAQRE
SADVVDKLNDLNSSVSQLEMKSLISKSVSREKQEKGRANLAQLGALYQPSWESQFVSGGE
ECFLISQFCCEVRKDEHVEKENTYTSYLDKFFSRKEDSEMLETEPVEEGKRGERGREAGL
LSSGGEFLLSRQLESIGTPQFHSPGGSPLKSIQATLTPSAMKSSPQIPHKTYSNILKHLN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggctttgatctgggttccaggtac
atggacttaaaaccattgggctgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtcctcaccgatccccagagtgtcaaa
catgccctccgtgaaatcaaaattattagaagacttgaccacgataacattgtgaaagtg
tttgaaattcttggtcccagtggaagccagctgacagacgatgtgggctctctaacagag
ctgaatagcgtctacattgttcaggagtacatggagacagacttggcgaacgtgctggag
cagggccctttactggaggagcatgccaggctcttcatgtaccagctgctgcgtgggctc
aagtacatccactctgcaaacgtgctgcacagggatctcaagccggccaaccttttcatt
aacactgaagacttggtgctgaagattggtgactttggcctggcccggatcatggatcct
cattattcccataagggtcatctttctgaaggattggttaccaaatggtacagatctcca
cggcttttactttctcctaataactatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagctgatcttggagtctatccctgttgtgcacgaggaagatcggcaggagcttctc
agcgtgattccagtttacattagaaacgacatgactgagccacacaaaccgctgactcag
ctgcttccggggattagtcgggaagcactggatttcctggaacagattctgacgttcagt
cccatggaccggctgacagccgaggaagcactttcccatccttacatgagcatctactct
ttcccaacggacgagcctatttccagccatcctttccacatagaagacgaagtggacgac
attttgctaatggatgaaacacacagtcacatttataactgggaaaggtaccacgattgt
cagttctcggagcatgactggcctattcataacaactttgatatcgatgaggttcagctt
gacccgagagctctgtctgatgtcaccgatgaagaagaagttcaagttgatcctcgaaag
tacttggatggagaccgagagaagtatctggaggatcccgccttcgacaccagctactct
gctgagccttgctggcagtacccagatcaccacgagaacaagtactgtgatctggagtgt
agccacacctgtaactacaaaacaaggtcgccatcatacttagataacctggtgtggagg
gagagcgaggttaaccattactatgagcccaagcttattatagatctttccaactggaaa
gagcaaagtaaggacaaatccgacaagagaggcaagtccaagtgtgagaggaacgggttg
gtcaaggcgcagattgcgcttgaggaagcgtcccagcagctggctgagagggagaggggc
caaggctttgactttgatgccttcatcgcaggcaccgttcagctcagtgcccagcgtgag
tctgctgacgtagttgacaagttaaacgacttgaatagctcagtgtcccagctagaaatg
aaaagcctgatatccaagtcagtcagccgagaaaagcaagaaaagggaagggctaacctg
gcccagctgggagccttgtaccagccctcctgggagagccagtttgtgagtggcggggag
gagtgcttccttatcagtcagttttgttgtgaggtcaggaaggacgaacacgtggagaag
gagaacacttacaccagctatttggacaagttttttagcaggaaggaggattctgaaatg
ctagaaactgagccagtggaagaagggaagcgtggggagagaggccgtgaggcagggctt
ctgagcagcggtggggagtttctcctgagcaggcagctagagtccataggcaccccgcag
ttccacagtccagggggatccccactcaagtccatccaggccacgttaacaccttccgct
atgaaatcttcccctcaaatccctcacaagacatacagcaacattctgaaacatctgaac
taa

DBGET integrated database retrieval system