KEGG   Rattus norvegicus (rat): 58918Help
Entry
58918             CDS       T01003                                 

Gene name
Casp9, Apaf3, Casp-9-CTD, Casp9_v1, Ice-Lap6, Mch6
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04115  p53 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04370  VEGF signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05010  Alzheimer's disease
rno05012  Parkinson's disease
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05016  Huntington's disease
rno05134  Legionellosis
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05164  Influenza A
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05215  Prostate cancer
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05416  Viral myocarditis
Module
rno_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    58918 (Casp9)
   04151 PI3K-Akt signaling pathway
    58918 (Casp9)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    58918 (Casp9)
   04215 Apoptosis - multiple species
    58918 (Casp9)
   04115 p53 signaling pathway
    58918 (Casp9)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    58918 (Casp9)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    58918 (Casp9)
   05210 Colorectal cancer
    58918 (Casp9)
   05212 Pancreatic cancer
    58918 (Casp9)
   05215 Prostate cancer
    58918 (Casp9)
   05213 Endometrial cancer
    58918 (Casp9)
   05222 Small cell lung cancer
    58918 (Casp9)
   05223 Non-small cell lung cancer
    58918 (Casp9)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    58918 (Casp9)
   05012 Parkinson's disease
    58918 (Casp9)
   05014 Amyotrophic lateral sclerosis (ALS)
    58918 (Casp9)
   05016 Huntington's disease
    58918 (Casp9)
  Cardiovascular diseases
   05416 Viral myocarditis
    58918 (Casp9)
  Infectious diseases
   05134 Legionellosis
    58918 (Casp9)
   05152 Tuberculosis
    58918 (Casp9)
   05164 Influenza A
    58918 (Casp9)
   05161 Hepatitis B
    58918 (Casp9)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    58918 (Casp9)
   05145 Toxoplasmosis
    58918 (Casp9)
  Drug resistance
   01524 Platinum drug resistance
    58918 (Casp9)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     58918 (Casp9)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     58918 (Casp9)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C14: caspase family
   58918 (Casp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD CARD_2
Motif
Other DBs
NCBI-GeneID: 58918
NCBI-ProteinID: NP_113820
RGD: 61867
Ensembl: ENSRNOG00000012944
UniProt: Q9JHK1
Position
5q36
AA seq 454 aa AA seqDB search
MEEADRQLLRRCRVRLVRELQVAELWDALLSRELFTRDMIEDIQRAGSGSRRDQARQLVI
DLETRGRQALPRFISCLEDTGQGSLASFLQSSGQAAKQDPEAVTPLDHLVPVVLGPMGLK
SKEQKVVKLDPSQPALGNLTPVVLGPEELWPTRLRPEVLTPETPRPVDIGSGRAHDVCTP
GKIERHADMAYTLDSDPCGHCLIINNVNFCPSSGLSTRIGSHVDCEKLQHRFCWLRFMVE
VKNDLTAKKMVTALMEMAHRDHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIER
IVNIFNGTGCPSLGGKPKLFFIQACGGEQKDHGFEVAFTSSQDKAFDSDSEPDAVPYQEG
PRTLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGVLEQWARSEDLQS
LLLRVANAVSEKGVYKQIPGCFNFLRKKLFFKTS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggctgaccggcaactcctgcggcgatgcagggtacgccttgtgcgcgaactg
caagtcgcggagctgtgggacgctctgctgagtcgtgagctcttcacgcgcgacatgatc
gaggatattcagcgggcaggctctgggtctcggcgggatcaggccaggcagctggtcata
gatcttgagactcgagggaggcaggcccttcctcgcttcatctcctgcttagaggacaca
ggccaaggctctctggcttcattcttgcaaagcagtgggcaagcagccaagcaggatcca
gaagctgttacacccctagaccacctggtgcctgtggtcctgggaccaatgggactcaaa
tcaaaggagcagaaagtagtgaagctggacccatctcagcctgccttgggaaacctcacc
ccagtggtgctggggccggaagagctctggcctactcggctcaggccagaggttctcaca
ccagaaacacccaggccggtggacattggttctggcagagctcatgatgtctgtactcca
gggaagatcgagagacatgcagatatggcatacaccctggactcggatccctgtggccac
tgcctcatcatcaacaacgtgaacttctgcccttcctcagggctcagcacacgcattggc
tcccacgtggactgtgagaagcttcagcaccgcttctgctggctgcgcttcatggtggag
gtgaagaacgacctgactgctaagaaaatggtcacggctttgatggagatggcgcaccgc
gaccaccgtgccctggactgcttcgtggtggtcatcctctctcatggctgccaggccagc
cacctccagttcccgggtgctgtctatggcacagatggatgctctgtgtccatcgagaga
attgtgaacatcttcaatgggaccggctgccccagcctgggagggaagcccaagctgttc
ttcatccaggcctgtggtggtgagcagaaagaccatggctttgaggtggccttcacttcc
tctcaagacaaggccttcgacagtgactctgagccagatgctgtcccataccaggaaggc
ccaaggaccttggaccagctggacgcagtgtcaagtttgcccacccccagtgacatcctt
gtgtcctactccaccttcccaggttttgtctcctggagagacaagaagagcggttcctgg
tacatcgagaccttggatggtgtcctggagcagtgggctcgctcggaagacctgcagtcc
ctccttctcagggtcgccaatgctgtttctgagaaaggggtttataagcagattcctggc
tgttttaacttcctccggaagaagctgttctttaaaacttcatga

DBGET integrated database retrieval system